DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2082 and NDL3

DIOPT Version :9

Sequence 1:NP_001163513.1 Gene:CG2082 / 40713 FlyBaseID:FBgn0027608 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_179552.1 Gene:NDL3 / 816481 AraportID:AT2G19620 Length:347 Species:Arabidopsis thaliana


Alignment Length:311 Identity:80/311 - (25%)
Similarity:144/311 - (46%) Gaps:56/311 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KYNISTEKC-GDLTVIVQGDLSQQEKRAVFITVHDLGCNHNS-FQE-FVSSPCMTEIKERSCFIH 86
            ::::.|  | |.::|:|.||   |||.|: ||..|:..|:.| ||. |:....::.:....|..|
plant    21 EHHVKT--CHGSVSVVVYGD---QEKPAL-ITYPDVALNYMSCFQGLFLCPEAVSLLLHNFCIYH 79

  Fly    87 VDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVL 151
            :..|||...|..:....|.||::.|.:.::.||::..::.|:.:|..|||.:|:.|.:.|..|||
plant    80 ISPPGHEFGAAPVCSNDPSPSVEDLADQILEVLNFFSLEAVMCMGITAGAYILSLFAIKHKERVL 144

  Fly   152 GLILINATGSAASVVQSFKNKFISWKSDEVAQSAESFLMYHKFGHVMEQIV----------GENP 206
            |||||:....|.|..:.|..|.:|           :.|.|:....:::.|.          |.:.
plant   145 GLILISPLCKAPSWSEWFYYKVVS-----------NLLYYYGMSGLLKDIFLQRYFSKEARGSSE 198

  Fly   207 DKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLT--LKGCKVDVILITGMLSPYASMVEKLH- 268
            ..|:.|....:||....:..::..:::|...|.|||  ||..|...::..|..||:.|  |.|| 
plant   199 VPERDVVHECRRLLGERHGSSLMRFLEAVNRRHDLTDGLKSLKCRTLIFVGDQSPFHS--ETLHM 261

  Fly   269 -RDVEKERVTILKIERAGDVLAD--------------------APGKVAQS 298
             ..::::...:::::..|.::.:                    .||:|:.|
plant   262 VTALDRKYSALVEVQACGSMVTEEQPHAMLIPMEFFFMGFGLYRPGRVSDS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2082NP_001163513.1 Abhydrolase 26..310 CDD:419691 80/310 (26%)
NDL3NP_179552.1 Ndr 21..305 CDD:397285 76/302 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2931
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D854690at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1173
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11034
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.