DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2082 and ndrg1a

DIOPT Version :9

Sequence 1:NP_001163513.1 Gene:CG2082 / 40713 FlyBaseID:FBgn0027608 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_998513.2 Gene:ndrg1a / 792085 ZFINID:ZDB-GENE-030826-34 Length:392 Species:Danio rerio


Alignment Length:305 Identity:90/305 - (29%)
Similarity:150/305 - (49%) Gaps:27/305 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RAVFITVHDLGCNHNS-FQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGE 113
            |.|.:|.||:|.||.| |....|...|.||.:.....|||.||..:.|...:.|:.:||:..|.|
Zfish    53 RPVILTFHDIGLNHKSCFDTLFSHEDMQEIMQHFAVCHVDAPGQQEGANTFSTGYEYPSMDQLSE 117

  Fly   114 DLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKS 178
            .|.::|.:..:|.|||:..||||.:|::|.|.:|:.|.||:|||....|...:....:|...|  
Zfish   118 TLPSILKHFGLKSVIGMAIGAGAYILSKFALDYPAMVEGLVLININPCAEGWMDWAAHKISGW-- 180

  Fly   179 DEVAQSAESFLMYHKFGHVMEQIVGENPDKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTL 243
               ..:....::.|.||   ::.:.:|.|   ::..|:..:...:|..|:.|:||::.:|:||.:
Zfish   181 ---THAMPDMIISHLFG---KEEIQQNHD---LIGRYRHHIVNEMNQYNLQLFVKSYTSRRDLEI 236

  Fly   244 -----------KGCKVDVILITGMLSPYASMVEKLHRDVEKERVTILKIERAGDV-LADAPGKVA 296
                       :..|...:|:.|..||....|.:.:..::..:.|:||:...|.: ..|.|||:.
Zfish   237 ERPVAGSHINARTLKCPALLVVGDSSPAVDAVVECNTKLDPTKTTLLKMADCGGLPQVDQPGKLT 301

  Fly   297 QSILLFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLS 341
            ::...|.:|.|.:.|..|..:.|.|   |||..|:...:|:|..|
Zfish   302 EAFKYFIQGMGYMPSASMTRLVRSR---TASGSSITSFDGNRSRS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2082NP_001163513.1 Abhydrolase 26..310 CDD:419691 79/272 (29%)
ndrg1aNP_998513.2 Ndr 31..315 CDD:251726 79/272 (29%)
MhpC 48..310 CDD:223669 77/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595957
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2931
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11034
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5286
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.