DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2082 and ndrg4

DIOPT Version :9

Sequence 1:NP_001163513.1 Gene:CG2082 / 40713 FlyBaseID:FBgn0027608 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_005163134.1 Gene:ndrg4 / 692305 ZFINID:ZDB-GENE-060512-226 Length:458 Species:Danio rerio


Alignment Length:328 Identity:82/328 - (25%)
Similarity:152/328 - (46%) Gaps:43/328 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GDLTVIVQGDLSQQEKRAVFITVHDLGCNHN-SFQEFVSSPCMTEIKERSCFIHVDVPGHADNAE 97
            |.|.|:::|  :.:..:...:|.||:|.||. .|..|..:..|.||.:.....|||.||....|.
Zfish   122 GMLHVVIRG--APKGNKPAILTYHDVGLNHKLCFNSFFQNEDMLEITKHFVVCHVDAPGQHIGAP 184

  Fly    98 ALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSA 162
            .:..|:.:|::..|...|.:|:.:...|.::|:|.||||.:||:|.|..|..|.||:|:|...:.
Zfish   185 QMPQGYQYPTMDQLAGMLPSVVQHFGFKSIVGIGVGAGAYILAKFALIFPDLVEGLVLLNIDPNG 249

  Fly   163 ASVVQSFKNKFISW---KSDEVAQSAESFLMYHKFGHVMEQIVGENPDKEKIVAEYQKRLHRSLN 224
            ..        :|.|   |...:..:....::.|.|.  .|:::...    ::|..|:::::.::|
Zfish   250 KG--------WIDWAATKLSGLTSTLPDTVLTHLFS--QEELMSNT----EVVQNYRQQINNTIN 300

  Fly   225 SKNIGLYVKAFMNRKDLTL---------KGCKVDVILITGMLSPYASMVEKLHRDVEKERVTILK 280
            ..|:.|:...:.:|:||.:         |..:..|:|:.|..:|....|.:.:..::....|.||
Zfish   301 QFNLQLFWNMYNSRRDLEMNRSGSVINAKTLRCPVMLVVGDNAPAEEGVVECNSKLDPTNTTFLK 365

  Fly   281 IERAGDV-LADAPGKVAQSILLFCKGQGLLT-------------SVVMPGVDRGRAFSTASSGSL 331
            :..:|.: ....|||:.::...|.:|.|.:.             |..|..:.|.|..|..|:||:
Zfish   366 MADSGGMPQITQPGKLTEAFKYFLQGMGYIAYMKDRRMSGGPVPSASMTRLARSRTASLTSAGSV 430

  Fly   332 EGA 334
            :|:
Zfish   431 DGS 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2082NP_001163513.1 Abhydrolase 26..310 CDD:419691 73/289 (25%)
ndrg4XP_005163134.1 Ndr 114..396 CDD:251726 73/289 (25%)
MhpC 168..391 CDD:223669 56/236 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.