DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2082 and NDRG2

DIOPT Version :9

Sequence 1:NP_001163513.1 Gene:CG2082 / 40713 FlyBaseID:FBgn0027608 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001341487.1 Gene:NDRG2 / 57447 HGNCID:14460 Length:389 Species:Homo sapiens


Alignment Length:372 Identity:103/372 - (27%)
Similarity:171/372 - (45%) Gaps:50/372 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PGTPKHGAGSSSAAA--APEKISKYNISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNS- 65
            ||.....|..:..||  ..::...:::.| ..|.:|..|.|  :.:.||...:|.||:|.|:.| 
Human    17 PGQTPEAAKEAELAARILLDQGQTHSVET-PYGSVTFTVYG--TPKPKRPAILTYHDVGLNYKSC 78

  Fly    66 FQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGL 130
            ||.......|.||.:....:|||.||..:.|.....|:.:|||..|.:.:..||.||:...:||:
Human    79 FQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGV 143

  Fly   131 GEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISW---KSDEVAQSAESFLMYH 192
            |.||||.:|||:.|.||..|.||:|||...:|..        ::.|   |...:..|....::.|
Human   144 GVGAGAYILARYALNHPDTVEGLVLINIDPNAKG--------WMDWAAHKLTGLTSSIPEMILGH 200

  Fly   193 KFGHVMEQIVGENPDKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLK-----GCKVDVIL 252
            .|.  .|::.|.:    :::.:|:..:..:.|..||.||..::.||:||..:     ..:..|:|
Human   201 LFS--QEELSGNS----ELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVML 259

  Fly   253 ITGMLSPYASMV------------------EKLHRDVEKERVTILKI-ERAGDVLADAPGKVAQS 298
            :.|..:|:...|                  .:.:..::..:.:.||: :..|......|||:.::
Human   260 VVGDQAPHEDAVGDQLWGTKNLIPASCLLQVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEA 324

  Fly   299 ILLFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLSRGIS 345
            ...|.:|.|.:.|..|..:.|.|..|..|:.|::| |.||  ||.:|
Human   325 FKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDG-NRSR--SRTLS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2082NP_001163513.1 Abhydrolase 26..310 CDD:419691 84/311 (27%)
NDRG2NP_001341487.1 Ndr 40..336 CDD:251726 84/312 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159735
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2931
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11034
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5286
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.