DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2082 and NDRG3

DIOPT Version :9

Sequence 1:NP_001163513.1 Gene:CG2082 / 40713 FlyBaseID:FBgn0027608 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_006723900.1 Gene:NDRG3 / 57446 HGNCID:14462 Length:388 Species:Homo sapiens


Alignment Length:357 Identity:99/357 - (27%)
Similarity:164/357 - (45%) Gaps:53/357 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KYNISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNS-FQEFVSSPCMTEIKERSCFIHVD 88
            :::|.|.. |.:.|.::|  ..:..|.|.:|.||:|.||.| |..|.:...|.||.:.....|||
Human    32 EHDIETTH-GVVHVTIRG--LPKGNRPVILTYHDIGLNHKSCFNAFFNFEDMQEITQHFAVCHVD 93

  Fly    89 VPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGL 153
            .||..:.|.:...|:.:|::..|.|.|..||.:|.:|.:||:|.||||.:|:||.|.||..|.||
Human    94 APGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAGAYILSRFALNHPELVEGL 158

  Fly   154 ILINATGSAASVVQSFKNKFISWKSDEVA---QSAESFLMYHKFGHVMEQIVGENPDKEKIVAEY 215
            :|||....|..        :|.|.:.:::   .:....::.|.||   ::.:..|.|   ::..|
Human   159 VLINVDPCAKG--------WIDWAASKLSGLTTNVVDIILAHHFG---QEELQANLD---LIQTY 209

  Fly   216 QKRLHRSLNSKNIGLYVKAFMNRKDLTL------------KGCKVDVILITGMLSPYASMVEKLH 268
            :..:.:.:|..|:.|::.::..|:||.:            |..|...:|:.|..||....|.:.:
Human   210 RMHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECN 274

  Fly   269 RDVEKERVTILKIERAGDV-LADAPGKVAQSILLFCKGQGLL-------------TSVVMPGVDR 319
            ..:.....|:||:...|.: ....|||:.::...|.:|.|.:             .|..|..:.|
Human   275 SRLNPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPYVQLSHLSTESVPSASMTRLAR 339

  Fly   320 GRAFSTASS-GSLEGANGSRRLSRGISMEDYD 350
            .|..||:|| ||     |....||.::....|
Human   340 SRTHSTSSSLGS-----GESPFSRSVTSNQSD 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2082NP_001163513.1 Abhydrolase 26..310 CDD:419691 85/313 (27%)
NDRG3XP_006723900.1 Ndr 32..317 CDD:397285 85/301 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159734
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2931
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11034
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5286
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.