DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2082 and MESK2

DIOPT Version :9

Sequence 1:NP_001163513.1 Gene:CG2082 / 40713 FlyBaseID:FBgn0027608 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_995914.1 Gene:MESK2 / 37451 FlyBaseID:FBgn0043070 Length:485 Species:Drosophila melanogaster


Alignment Length:357 Identity:111/357 - (31%)
Similarity:173/357 - (48%) Gaps:41/357 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EKISKYNISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNH-NSFQEFVSSPCMTEIKERSCF 84
            |...:..:.|:| ||:.|.:|||.:    :...||.||||.|: .||..|.:.|.|..:.|..|.
  Fly    44 EACEQRRVPTDK-GDVHVAIQGDTA----KPAIITYHDLGLNYATSFAGFFNFPVMRGLLENFCV 103

  Fly    85 IHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSR 149
            .||..||..:.|..|.:.:.:|::..|...|:.||.:..:|.|||.|.|||||:||||..|||.:
  Fly   104 YHVTAPGQEEGAPTLPEDYVYPTMDDLAAQLLFVLSHFGLKSVIGFGVGAGANILARFAHAHPDK 168

  Fly   150 VLGLILINATGSAASVV----QSFKNKFISWKSDEVAQSAESFLMYHKFGHVMEQIVGENPDKEK 210
            |..|.|||...:.:..:    |||..:|:..|.  :.|....:||:|.|        |.||::..
  Fly   169 VGALCLINCVSTQSGWIEWGYQSFNARFLRTKG--MTQGVIDYLMWHHF--------GRNPEERN 223

  Fly   211 --IVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTL--------------KGCKVDVILITGMLSP 259
              :|..|::...|.:|..|:.:.:.|:::|.||.|              ...|:.||.|||.|||
  Fly   224 HDLVQMYKQHFERGVNPTNLAMLINAYIHRNDLHLARTPPGTPGSETAATTLKMPVINITGSLSP 288

  Fly   260 YASMVEKLHRDVEKERVTILKIERAGDVLADAPGKVAQSILLFCKGQGLLTSVVMPGVDR-GRAF 323
            :.......:..::....:.:||.....||.:.|.|:|::..||.:|:|..|.:..|.... |..:
  Fly   289 HVDDTVTFNGRLDPTNSSWMKISDCALVLEEQPAKLAEAFRLFLQGEGYATPLSTPASSPCGTKY 353

  Fly   324 STASSGSLEGANGSRRLSRGISMEDYDKPNIR 355
            .|.|  |:..||...:..:  :||:.|:...|
  Fly   354 HTYS--SIFFANFREQQQQ--AMEERDRERER 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2082NP_001163513.1 Abhydrolase 26..310 CDD:419691 98/304 (32%)
MESK2NP_995914.1 Abhydrolase 51..337 CDD:304388 97/300 (32%)
MhpC 57..334 CDD:223669 93/290 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470276
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2931
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1173
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11034
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5286
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.