DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2082 and Ndrg3

DIOPT Version :9

Sequence 1:NP_001163513.1 Gene:CG2082 / 40713 FlyBaseID:FBgn0027608 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001342320.1 Gene:Ndrg3 / 29812 MGIID:1352499 Length:388 Species:Mus musculus


Alignment Length:357 Identity:100/357 - (28%)
Similarity:166/357 - (46%) Gaps:53/357 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KYNISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNS-FQEFVSSPCMTEIKERSCFIHVD 88
            :::|.|.. |.:.|.::|  ..:..|.|.:|.||:|.||.| |..|.:...|.||.:.....|||
Mouse    32 EHDIETPH-GMVHVTIRG--LPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVD 93

  Fly    89 VPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGL 153
            .||..:.|.:...|:.:|::..|.|.|..||.:|.:|.:||:|.||||.:|:||.|.||..|.||
Mouse    94 APGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGL 158

  Fly   154 ILINATGSAASVVQSFKNKFISWKSDEVA---QSAESFLMYHKFGHVMEQIVGENPDKEKIVAEY 215
            :|||....|..        :|.|.:.:::   .:....::.|.||   ::.:..|.|   ::..|
Mouse   159 VLINIDPCAKG--------WIDWAASKLSGFTTNIVDIILAHHFG---QEELQANLD---LIQTY 209

  Fly   216 QKRLHRSLNSKNIGLYVKAFMNRKDL------------TLKGCKVDVILITGMLSPYASMVEKLH 268
            :..:.:.:|.:|:.|::.::..|:||            .||..|...:|:.|..||....|.:.:
Mouse   210 RLHIAQDINQENLQLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECN 274

  Fly   269 RDVEKERVTILKIERAGDV-LADAPGKVAQSILLFCKGQGLL-------------TSVVMPGVDR 319
            ..::....|:||:...|.: ....|||:.::...|.:|.|.:             .|..|..:.|
Mouse   275 SRLDPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPYVQLSHLSSESVPSASMTRLAR 339

  Fly   320 GRAFSTASS-GSLEGANGSRRLSRGISMEDYD 350
            .|..||:|| ||     |....||.::....|
Mouse   340 SRTHSTSSSIGS-----GESPFSRSVTSNQSD 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2082NP_001163513.1 Abhydrolase 26..310 CDD:419691 86/313 (27%)
Ndrg3NP_001342320.1 Ndr 32..317 CDD:397285 86/301 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850103
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2931
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11034
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5286
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.830

Return to query results.
Submit another query.