DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2082 and Ndrg3

DIOPT Version :9

Sequence 1:NP_001163513.1 Gene:CG2082 / 40713 FlyBaseID:FBgn0027608 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_038960545.1 Gene:Ndrg3 / 296318 RGDID:1359424 Length:388 Species:Rattus norvegicus


Alignment Length:357 Identity:100/357 - (28%)
Similarity:166/357 - (46%) Gaps:53/357 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KYNISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNS-FQEFVSSPCMTEIKERSCFIHVD 88
            :::|.|.. |.:.|.::|  ..:..|.|.:|.||:|.||.| |..|.:...|.||.:.....|||
  Rat    32 EHDIETPH-GMVHVTIRG--LPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVD 93

  Fly    89 VPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGL 153
            .||..:.|.:...|:.:|::..|.|.|..||.:|.:|.:||:|.||||.:|:||.|.||..|.||
  Rat    94 APGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGL 158

  Fly   154 ILINATGSAASVVQSFKNKFISWKSDEVA---QSAESFLMYHKFGHVMEQIVGENPDKEKIVAEY 215
            :|||....|..        :|.|.:.:::   .:....::.|.||   ::.:..|.|   ::..|
  Rat   159 VLINIDPCAKG--------WIDWAASKLSGLTTNVVDIILAHHFG---QEELQANLD---LIQTY 209

  Fly   216 QKRLHRSLNSKNIGLYVKAFMNRKDL------------TLKGCKVDVILITGMLSPYASMVEKLH 268
            :..:.:.:|.:|:.|::.::..|:||            .||..|...:|:.|..||....|.:.:
  Rat   210 RLHIAQDINQENLQLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECN 274

  Fly   269 RDVEKERVTILKIERAGDV-LADAPGKVAQSILLFCKGQGLL-------------TSVVMPGVDR 319
            ..::....|:||:...|.: ....|||:.::...|.:|.|.:             .|..|..:.|
  Rat   275 SRLDPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPYVQLSHLSSESVPSASMTRLAR 339

  Fly   320 GRAFSTASS-GSLEGANGSRRLSRGISMEDYD 350
            .|..||:|| ||     |....||.::....|
  Rat   340 SRTHSTSSSIGS-----GESPFSRSVTSNQSD 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2082NP_001163513.1 Abhydrolase 26..310 CDD:419691 86/313 (27%)
Ndrg3XP_038960545.1 Ndr 32..317 CDD:397285 86/301 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11034
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.