DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2082 and Ndrg4

DIOPT Version :9

Sequence 1:NP_001163513.1 Gene:CG2082 / 40713 FlyBaseID:FBgn0027608 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001359350.1 Gene:Ndrg4 / 234593 MGIID:2384590 Length:404 Species:Mus musculus


Alignment Length:328 Identity:90/328 - (27%)
Similarity:151/328 - (46%) Gaps:43/328 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GDLTVIVQGDLSQQEKRAVFITVHDLGCNHN-SFQEFVSSPCMTEIKERSCFIHVDVPGHADNAE 97
            |.|.|:::|  |.:..|...:|.||:|.||. .|..|.:...|.||.:.....|||.||....|.
Mouse    68 GLLHVVIRG--SPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGAS 130

  Fly    98 ALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSA 162
            ....|:.|||::.|...|.:|:.:...|||||:|.||||.|||:|.|..|..|.||:|:|...:.
Mouse   131 QFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLMNIDPNG 195

  Fly   163 ASVVQSFKNKFISW---KSDEVAQSAESFLMYHKFGHVMEQIVGENPDKEKIVAEYQKRLHRSLN 224
            ..        :|.|   |...:..:....::.|.|.  .|::|    :..::|..|::::...:|
Mouse   196 KG--------WIDWAATKLSGLTSTLPDTVLSHLFS--QEELV----NNTELVQSYRQQISNVVN 246

  Fly   225 SKNIGLYVKAFMNRKDLTL---------KGCKVDVILITGMLSPYASMVEKLHRDVEKERVTILK 280
            ..|:.|:...:.:|:||.:         |..:..|:|:.|..:|....|.:.:..::....|.||
Mouse   247 QANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEEGVVECNSKLDPTTTTFLK 311

  Fly   281 IERAGDV-LADAPGKVAQSILLFCKGQGLLT-------------SVVMPGVDRGRAFSTASSGSL 331
            :..:|.: ....|||:.::...|.:|.|.:.             |..|..:.|.|..|..|:.|:
Mouse   312 MADSGGLPQVTQPGKLTEAFKYFLQGMGYIAHLKDRRLSGGAVPSASMTRLARSRTASLTSASSV 376

  Fly   332 EGA 334
            :|:
Mouse   377 DGS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2082NP_001163513.1 Abhydrolase 26..310 CDD:419691 82/289 (28%)
Ndrg4NP_001359350.1 Ndr 60..342 CDD:335213 82/289 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850104
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2931
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.