DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2082 and NDRG1

DIOPT Version :9

Sequence 1:NP_001163513.1 Gene:CG2082 / 40713 FlyBaseID:FBgn0027608 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001361773.1 Gene:NDRG1 / 10397 HGNCID:7679 Length:411 Species:Homo sapiens


Alignment Length:378 Identity:96/378 - (25%)
Similarity:159/378 - (42%) Gaps:64/378 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EKCGDLTVIVQG-DLSQQE------------------KRAVFITVHDLGCNHNS-FQEFVSSPCM 75
            ||...:|.::|. |:.:|:                  .|.|.:|.||:|.||.: :....:...|
Human    18 EKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDM 82

  Fly    76 TEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLA 140
            .||.:.....|||.||..|.|.:...|:.:||:..|.|.|..||....:|.:||:|.||||.:|.
Human    83 QEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILT 147

  Fly   141 RFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEV--------------------AQSA 185
            ||.|.:|..|.||:|||....|..        ::.|.:.:|                    .|:.
Human   148 RFALNNPEMVEGLVLINVNPCAEG--------WMDWAASKVRWGPVRPAGSLQEEGQISGWTQAL 204

  Fly   186 ESFLMYHKFGHVMEQIVGENPDKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLK------ 244
            ...::.|.||.      .|.....::|..|::.:...:|..|:.|::.|:.:|:||.::      
Human   205 PDMVVSHLFGK------EEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGT 263

  Fly   245 ---GCKVDVILITGMLSPYASMVEKLHRDVEKERVTILKIERAGDV-LADAPGKVAQSILLFCKG 305
               ..:...:|:.|..||....|.:.:..::..:.|:||:...|.: ....|.|:|::...|.:|
Human   264 HTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQG 328

  Fly   306 QGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLSRGISMEDYDKPNIRRLS 358
            .|.:.|..|..:.|.|..|.:|..||:|.......|.|.....:.....|..|
Human   329 MGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2082NP_001163513.1 Abhydrolase 26..310 CDD:419691 83/328 (25%)
NDRG1NP_001361773.1 Ndr 34..333 CDD:335213 78/312 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159737
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2931
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11034
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5286
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.