DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2091 and DCPS

DIOPT Version :9

Sequence 1:NP_649582.1 Gene:CG2091 / 40711 FlyBaseID:FBgn0037372 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001337165.1 Gene:DCPS / 28960 HGNCID:29812 Length:344 Species:Homo sapiens


Alignment Length:307 Identity:128/307 - (41%)
Similarity:186/307 - (60%) Gaps:22/307 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SKFQLKRILTNNSVRKSISLLGTFP-----------DLGTDDAIVVFEKNAYRESDVATASSEES 71
            |.|:|:::|..::..|.|.|.|..|           |...:||:|:.||..::...||       
Human    45 SGFRLQKVLRESARDKIIFLHGKVPGGNPEVNEASGDGDGEDAVVILEKTPFQVEQVA------- 102

  Fly    72 PKKPSYFTADLKVDTEFINNIYGSFQVVPTQDLCSVKSTVIYPATEKHIEKYSVSQKYLIRETPD 136
                ...|...::..:|.|:||.::.:.|.:.|..||:||:|||||||::||......|||||.|
Human   103 ----QLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGD 163

  Fly   137 LYQRITLPYLTSSQFSLEWVYNILEHKQETERIVYEDRDPKTGFILLPDLKWDGRNVETLYLLGI 201
            .|:.||||:|.|...|::||||||:.|.|.:|||:|:.||..||:|:|||||:.:.::.|||:.|
Human   164 DYRNITLPHLESQSLSIQWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQQQLDDLYLIAI 228

  Fly   202 VHKRDIKSLRDLNESHLDLLRNVRQASKDAIAKLYGINPNQLRMYFHYQPSFYHLHVHINPVRND 266
            .|:|.|:|||||...||.||||:....::||.:.|.:..:.||:|.||.||:||||||...:..:
Human   229 CHRRGIRSLRDLTPEHLPLLRNILHQGQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHFTALGFE 293

  Fly   267 APGIWCEKSHMLDTVINNLELMPDYYQRATLPFVLYEGNKLLDLYEQ 313
            |||...|::|:|..||.|||..|.:||:.||.|.|...:.||.|.::
Human   294 APGSGVERAHLLAEVIENLECDPRHYQQRTLTFALRADDPLLKLLQE 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2091NP_649582.1 DcpS 15..124 CDD:283339 36/116 (31%)
COG5075 17..307 CDD:227407 125/299 (42%)
DcpS_C 155..260 CDD:288796 55/104 (53%)
DCPSNP_001337165.1 DcpS 47..336 CDD:331830 125/299 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158665
Domainoid 1 1.000 136 1.000 Domainoid score I4938
eggNOG 1 0.900 - - E1_COG5075
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32202
Inparanoid 1 1.050 247 1.000 Inparanoid score I3269
Isobase 1 0.950 - 0 Normalized mean entropy S1689
OMA 1 1.010 - - QHG58249
OrthoDB 1 1.010 - - D416175at33208
OrthoFinder 1 1.000 - - FOG0005125
OrthoInspector 1 1.000 - - oto89988
orthoMCL 1 0.900 - - OOG6_104575
Panther 1 1.100 - - LDO PTHR12978
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R300
SonicParanoid 1 1.000 - - X3646
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.