DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Madm and CDC5

DIOPT Version :9

Sequence 1:NP_001303420.1 Gene:Madm / 40710 FlyBaseID:FBgn0027497 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_013714.1 Gene:CDC5 / 855013 SGDID:S000004603 Length:705 Species:Saccharomyces cerevisiae


Alignment Length:540 Identity:126/540 - (23%)
Similarity:204/540 - (37%) Gaps:135/540 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 VQYASLQELKSQEEKMRQVFDNLLQLDHQNIVKFHRYWTDTQQAERPRVVFITEYMSSGSLKQFL 204
            |..||::..|::::.:.::..: ..:.|.|||:|...:.|..     .|..:.|...:|||.:.|
Yeast   112 VAKASIKSEKTRKKLLSEIQIH-KSMSHPNIVQFIDCFEDDS-----NVYILLEICPNGSLMELL 170

  Fly   205 KRTKRNAKRLPLESWRRWCTQILSALSYLHSCSPPIIHGNLTCDSIFIQHNGLVKIGSVVPDAVH 269
            ||    .|.|.....|.:.|||..|:.|:|  |..:||.:|...:||...|..:|||.       
Yeast   171 KR----RKVLTEPEVRFFTTQICGAIKYMH--SRRVIHRDLKLGNIFFDSNYNLKIGD------- 222

  Fly   270 YSVRRGRERERERER---GAHYFQAPE--YGAADQLTAALDIYAFGMCALEMAALEIQPSNSEST 329
            :.:......|.||:.   |...:.|||  .|.....:..:||::.|:.   :.||.|.....::.
Yeast   223 FGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVM---LYALLIGKPPFQAR 284

  Fly   330 AINE--ETIQRTIFSLENDLQ-----RDLIRKCLNPQPQDRPSANDLL--------FHPLLFEVH 379
            .:|.  |.|:...||...|..     :.|||..|:..|.:|||..:::        |.|.:    
Yeast   285 DVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSI---- 345

  Fly   380 SLKLLTAHCLVFSPANRTMFSETA-FDGLMQRYYQPDVVMAQLRLAGGQERQYRLADVSGADKLE 443
                         |:  |:.||.. |:.:.:.       .:.:......|:...|..:| :||::
Yeast   346 -------------PS--TVMSEAPNFEDIPEE-------QSLVNFKDCMEKSLLLESMS-SDKIQ 387

  Fly   444 K----FVEDVKYGVYPLITYSGKKPPNFRSRAASPERADSVKSATPEPVDTESRRIVNMMC---- 500
            :    ::..:|..:..|..|...:|  |...:.||   ...|....|.||.|::|.:|.:.    
Yeast   388 RQKRDYISSIKSSIDKLEEYHQNRP--FLPHSLSP---GGTKQKYKEVVDIEAQRRLNDLAREAR 447

  Fly   501 ------SVKIKE----DSNDITMTILLRMDDKMNRQLTCQVNENDTAADLTSE--LVRLGFVHLD 553
                  :|..||    .:|.|...|.||:                    |.||  |...|.|..:
Yeast   448 IRRAQQAVLRKELIATSTNVIKSEISLRI--------------------LASECHLTLNGIVEAE 492

  Fly   554 DQDKIQVLLEETL-----------------KAGVMSDGAGAESSGAGVTTTATMAALEQLERNWS 601
            .|.|:..|.:..|                 |.| .|.....|..|.......|:..|...|..|.
Yeast   493 AQYKMGGLPKSRLPKIKHPMIVTKWVDYSNKHG-FSYQLSTEDIGVLFNNGTTVLRLADAEEFWY 556

  Fly   602 ISSDADKQG-TAVMYVPQEQ 620
            ||.| |::| .|..|:..|:
Yeast   557 ISYD-DREGWVASHYLLSEK 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MadmNP_001303420.1 PK_NRBP1_like 114..376 CDD:270886 67/255 (26%)
S_TKc 123..375 CDD:214567 67/254 (26%)
CDC5NP_013714.1 STKc_PLK 80..337 CDD:271001 65/246 (26%)
POLO_box_1 510..601 CDD:240561 17/68 (25%)
POLO_box_2 613..698 CDD:240560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.