DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Madm and AT5G55560

DIOPT Version :9

Sequence 1:NP_001303420.1 Gene:Madm / 40710 FlyBaseID:FBgn0027497 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_200367.2 Gene:AT5G55560 / 835650 AraportID:AT5G55560 Length:314 Species:Arabidopsis thaliana


Alignment Length:305 Identity:97/305 - (31%)
Similarity:151/305 - (49%) Gaps:40/305 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SGDDSEDESE-----ILEESPCGRWLKRREEVDQRDVPGIDCVHLAMDTEEGVEVVWNEVQYASL 145
            |.||:|.|.:     .:|..|.||:.:..|.:..   ..:..|:.|.|.|||:||.||:|:....
plant     6 SSDDNESEKDKDSESFVEVDPTGRYGRYGELLGS---GAVKKVYRAFDQEEGIEVAWNQVKLRCF 67

  Fly   146 QELKSQEEKMRQVFDNLLQLDHQNIVKFHRYWTDTQQAERPRVV-FITEYMSSGSLKQFLKRTKR 209
            .:..:..|::......|..|.:.||:..::.|.|    ||...: ||||..:||:|:::.|:   
plant    68 SDDPAMTERLYSEVRLLKNLKNSNIITLYKVWRD----ERNNTLNFITEICTSGNLREYRKK--- 125

  Fly   210 NAKRLPLESWRRWCTQILSALSYLHSCSPPIIHGNLTCDSIFIQHN-GLVKIGSVVPDAVHYSVR 273
             .:.:.:.:.::|..|||..|.|||:..|.|||.:|.|.:||:..| |.||||.:...|:     
plant   126 -HRHVSMRALKKWSKQILKGLDYLHTHDPCIIHRDLNCSNIFVNGNIGQVKIGDLGLAAI----- 184

  Fly   274 RGRERERERERGAHYFQAPEYGAADQLTAALDIYAFGMCALEMAALEIQPSNSESTA-------- 330
            .|:........|...|.|||. ..:..|..:|||::|||.||:.:|||..|..:|.|        
plant   185 VGKNHLAHSILGTPEFMAPEL-YEENYTEMVDIYSYGMCVLELVSLEIPYSECDSVAKIYKRVSK 248

  Fly   331 -INEETIQRTIFSLENDLQ-RDLIRKCLNPQPQDRPSANDLLFHP 373
             :..|.:.:.     ||.: :..|.||: .||:.||||.:||..|
plant   249 GLKPEALNKV-----NDPEAKAFIEKCI-AQPRARPSAAELLCDP 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MadmNP_001303420.1 PK_NRBP1_like 114..376 CDD:270886 87/272 (32%)
S_TKc 123..375 CDD:214567 87/263 (33%)
AT5G55560NP_200367.2 STKc_WNK 29..289 CDD:270885 89/282 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D695382at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13902
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X143
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.