DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Madm and WNK6

DIOPT Version :9

Sequence 1:NP_001303420.1 Gene:Madm / 40710 FlyBaseID:FBgn0027497 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001189928.1 Gene:WNK6 / 821406 AraportID:AT3G18750 Length:567 Species:Arabidopsis thaliana


Alignment Length:527 Identity:141/527 - (26%)
Similarity:225/527 - (42%) Gaps:121/527 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 ESGDDSE-----DESEILEESPCGRWLKRREEVDQRDVPGIDCVHLAMDTEEGVEVVWNEVQYAS 144
            |..||:.     .:.|:||..|..|:::.:|.:.:   .....|:.|.|..:|:||.||:|:...
plant     2 EGTDDASALQEPPDPEVLEVDPTFRYIRYKEVIGK---GAFKTVYKAFDEVDGIEVAWNQVRIDD 63

  Fly   145 LQELKSQEEKMRQVFDNLLQLDHQNIVKFHRYWTDTQQAERPRVVFITEYMSSGSLKQFLKRTKR 209
            :.:..:..|::......|..|.|.||::|:..|.|.   :...|..|||..:||||:.:.|:   
plant    64 VLQSPNCLERLYSEVRLLKSLKHNNIIRFYNSWIDD---KNKTVNIITELFTSGSLRHYRKK--- 122

  Fly   210 NAKRLPLESWRRWCTQILSALSYLHSCSPPIIHGNLTCDSIFIQHN-GLVKIG-----SVVPDAV 268
             .:::.:::.:.|..|||..|.|||...|||||.:|.||:|||..| |.||||     :|:..|.
plant   123 -HRKVNMKAVKNWARQILMGLRYLHGQEPPIIHRDLKCDNIFINGNHGEVKIGDLGLATVMEQAN 186

  Fly   269 HYSVRRGRERERERERGAHYFQAPE-YGAADQLTAALDIYAFGMCALEMAALE---IQPSNSE-- 327
            ..||           .|...|.||| |.  :......|||:||||.|||...:   .:..||.  
plant   187 AKSV-----------IGTPEFMAPELYD--ENYNELADIYSFGMCMLEMVTFDYPYCECKNSAQI 238

  Fly   328 ----STAINEETIQRTIFSLENDLQRDLIRKCLNPQPQDRPSANDLLFHPLLFEVHSLKLLTAHC 388
                |:.|...::.|    :::...:..|.|||.| ..:|.||.:||..|.| :::.|       
plant   239 YKKVSSGIKPASLSR----VKDPEVKQFIEKCLLP-ASERLSAKELLLDPFL-QLNGL------- 290

  Fly   389 LVFSPANRTMFSETAFDGLMQRYYQPDVVMAQLRLAGGQERQYRLADVSGADKLEKFV-----ED 448
                    ||.:....         ||:||.:   .|....:..:::.....:..|.:     ||
plant   291 --------TMNNPLPL---------PDIVMPK---EGAFGDRCLMSEGPPTTRPSKTLSIDLDED 335

  Fly   449 VKYGVYPLITYSGKKPPNFRSRAASPERADSVKSATPEPVDTESRRIVNMMCSVKIKEDSNDITM 513
            ..   .|::|:|    .|..||.                  .|.||.......|...|::::.::
plant   336 SN---LPIVTFS----DNSGSRC------------------IEVRRAKRGNFFVLKGEENDEQSV 375

  Fly   514 TILLRMDDKMNRQLTCQ---VNENDTAADLTSELVRLGFVHLDDQ------DKIQVLLEE---TL 566
            :::||:.|:..|.....   ..|.|||:.::||:|..  :.|.||      :.|.:||..   |.
plant   376 SLILRIVDENGRVRNIHFLFYQEGDTASKVSSEMVEQ--LELTDQNVTFIAELIDILLVNMIPTW 438

  Fly   567 KAGVMSD 573
            |..|..|
plant   439 KTDVTVD 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MadmNP_001303420.1 PK_NRBP1_like 114..376 CDD:270886 88/277 (32%)
S_TKc 123..375 CDD:214567 88/267 (33%)
WNK6NP_001189928.1 STKc_WNK 26..285 CDD:270885 90/286 (31%)
S_TKc 32..285 CDD:214567 89/280 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D695382at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13902
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X143
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.