DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Madm and DSTYK

DIOPT Version :9

Sequence 1:NP_001303420.1 Gene:Madm / 40710 FlyBaseID:FBgn0027497 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_056190.1 Gene:DSTYK / 25778 HGNCID:29043 Length:929 Species:Homo sapiens


Alignment Length:193 Identity:36/193 - (18%)
Similarity:67/193 - (34%) Gaps:66/193 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LPLESWRRWCTQILSALSYLHSCSPPIIHGNLTCDSIFIQHNGLVKI-------------GSVVP 265
            |.||:..:....::..:.:||  |..::|.::...::.:......||             ||:|.
Human   749 LTLETRLQIALDVVEGIRFLH--SQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVG 811

  Fly   266 DAVHYSVRRGRERERERERGAHYFQAPEY--GAADQLTAALDIYAFGMCALEMAALEIQ-PSNSE 327
            ..:|                    .|||.  |..|.   ::|:||||:....:.:..:: |...|
Human   812 TPIH--------------------MAPELFTGKYDN---SVDVYAFGILFWYICSGSVKLPEAFE 853

  Fly   328 STAINEETIQRTIFSLENDLQR---------------DLIRKCLNPQPQDRPSANDLLFHPLL 375
            ..|..:.        |.|:::|               .|:..|.:..|..||...  :..|:|
Human   854 RCASKDH--------LWNNVRRGARPERLPVFDEECWQLMEACWDGDPLKRPLLG--IVQPML 906

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MadmNP_001303420.1 PK_NRBP1_like 114..376 CDD:270886 36/193 (19%)
S_TKc 123..375 CDD:214567 35/191 (18%)
DSTYKNP_056190.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PKc_Dusty 651..912 CDD:270877 36/193 (19%)
S_TKc 653..897 CDD:214567 32/180 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.