DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1236 and AT1G72190

DIOPT Version :9

Sequence 1:NP_649579.2 Gene:CG1236 / 40708 FlyBaseID:FBgn0037370 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_177364.2 Gene:AT1G72190 / 843551 AraportID:AT1G72190 Length:373 Species:Arabidopsis thaliana


Alignment Length:349 Identity:95/349 - (27%)
Similarity:157/349 - (44%) Gaps:53/349 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QVRNLLIQGHIIR--RMSSQHKVYVTR-----PDVDDSGLELLRKSCQVSTWHETNPVPRSELIR 66
            |.|::..|..:::  |:..:..::|||     |...|| ....|:..|...:.:.:.|...::..
plant    27 QARSISRQSKVVKIERIVEKEDMHVTRVLFCGPHFPDS-YNFTREYLQPYPFIKVDVVHYRDVPE 90

  Fly    67 VVAGKDALYC-ALTDKVDKEVLDAAGPQLKCVATISVGYDHIDVEECRKRGIRVGFTPDVLTDAT 130
            |:  |:...| |:|.::|..|:..|. .:|.:....||.|.:|::...|.||:|...|...|...
plant    91 VI--KNYHICVAMTMQMDSNVISRAS-NIKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNA 152

  Fly   131 A---ELTLALLLA------------TNRRLFEANKQVYNGGWKSWAPMWMCGQGLKGSRVGLLGF 180
            |   |:.:.|:|.            .||.|.|..                 |..|.|..|.:||:
plant   153 ASCSEMAIYLMLGLLKKQNEMQISLRNRLLGEPT-----------------GDTLLGKTVFILGY 200

  Fly   181 GRIGQEIAARIVPFKPTEITYTTRSLRPKEAAAVNAR-------HVDFDEMLRESDLIVVCCALT 238
            |.||.|:|.|:.||....|  .|:...|......::|       |.|......::|::|||..|.
plant   201 GNIGIELAKRLKPFGSRVI--ATKRFWPASIVDSDSRLVDEKGSHEDIYTFAGKADIVVVCLRLN 263

  Fly   239 PETKEIFNATAFQKMKPNCILINTARGGVVDQKALYEALKTKRILAAGLDVTTPEPLPIDDPLLK 303
            .||.||.|......||...:|:|.||||:::.::.::.|::..:...|:||...||...:||:||
plant   264 KETAEIVNKEFICSMKKGALLVNIARGGLINYESAFQNLESGHLGGLGIDVAWSEPFDPNDPILK 328

  Fly   304 LDNVVILPHIGSADIETRKEMSRI 327
            ..||:|.||:......:.:.|::|
plant   329 FKNVIITPHVAGVTEYSYRSMAKI 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1236NP_649579.2 GDH 27..338 CDD:240626 91/329 (28%)
LdhA 27..338 CDD:223980 91/329 (28%)
AT1G72190NP_177364.2 PLN02928 34..373 CDD:215501 93/342 (27%)
SerA 80..353 CDD:223189 83/295 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378766at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.