DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1236 and AT5G28310

DIOPT Version :9

Sequence 1:NP_649579.2 Gene:CG1236 / 40708 FlyBaseID:FBgn0037370 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_198183.1 Gene:AT5G28310 / 832915 AraportID:AT5G28310 Length:233 Species:Arabidopsis thaliana


Alignment Length:172 Identity:36/172 - (20%)
Similarity:69/172 - (40%) Gaps:55/172 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 RVGLLGFGRIGQEIAARIVPFKPTEITYTTRSLRPKEAAAVNARHVDFDEMLRESDLIVVCCALT 238
            |:|::|.|.||.::|.|:..| ..:|:|::|:.:|  .|.....::|.:||              
plant   116 RIGIVGLGSIGSKVATRLKAF-GCQISYSSRNRKP--YAVPYHYYMDIEEM-------------- 163

  Fly   239 PETKEIFNATAFQKMKPNCILINTARGGVVDQKALYEALKTKRILAAGLDVTTPEPLPIDDPLLK 303
                             :.:::|.|.|.::|::.:....|                     .|.:
plant   164 -----------------HGVIVNVALGAIIDEEEMSNVPK---------------------ELFE 190

  Fly   304 LDNVVILPHIGSADIETRKEMSRITARNILAALAGDKMVAEV 345
            |||||..||.....:|..:|:.::...||.|..:...::..|
plant   191 LDNVVFSPHCAFMTLEGLEELGKVVVGNIEAFFSNKPLLTPV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1236NP_649579.2 GDH 27..338 CDD:240626 35/163 (21%)
LdhA 27..338 CDD:223980 35/163 (21%)
AT5G28310NP_198183.1 NADB_Rossmann <115..224 CDD:304358 35/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378766at2759
OrthoFinder 1 1.000 - - FOG0000836
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X646
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.