DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1236 and SPAC186.07c

DIOPT Version :9

Sequence 1:NP_649579.2 Gene:CG1236 / 40708 FlyBaseID:FBgn0037370 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_595025.1 Gene:SPAC186.07c / 2542600 PomBaseID:SPAC186.07c Length:332 Species:Schizosaccharomyces pombe


Alignment Length:288 Identity:82/288 - (28%)
Similarity:132/288 - (45%) Gaps:33/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VVAGKDALYCA-LTDKVDKEVLDA-AGPQLKCVATISVGYDHIDVEECRKRGIRVGFTPDVLTDA 129
            |:|.|..:.|. :.||||.:.|.. |....|.:|....|::::|::.....||.|...|.....|
pombe    40 VLAEKAPVVCVFVNDKVDADTLKVLAKNGTKLIALRCAGFNNVDLKAAADNGITVVRVPAYSPYA 104

  Fly   130 TAELTLALLLATNRRLFEANKQV------YNGGWKSWAPMWMCGQGLKGSRVGLLGFGRIGQEIA 188
            .||.|:.|||:.||::..|..:|      .||         :.|..|.|..:||||.||||..:|
pombe   105 VAEYTIGLLLSLNRKIHRAYVRVREDDFNLNG---------LLGHDLHGKTIGLLGTGRIGGLVA 160

  Fly   189 ARIVPFKPTEITYTTRSLRP-KEAAAVNARHVDFDEMLRESDLIVVCCALTPETKEIFNATAFQK 252
            ..:......|:  ....::| ||......:.|:..|:|.::|.:.:.|.|||:|:.:.:......
pombe   161 KCLKLGFGCEV--LAHDIKPNKELEKFGIQFVEQQEVLAKADFLCLHCPLTPDTEHLVDEKLLAS 223

  Fly   253 MKPNCILINTARGGVVDQKALYEALKTKRILAAGLDVTTPEPL---------PIDD----PLLKL 304
            ||....:|||:|||:||.|||.:|:::.::....:||...|..         .|.|    .|...
pombe   224 MKKGVKIINTSRGGLVDTKALVKAIESGQVGGCAMDVYEGERRLFYRDLSNEVIKDTTFQQLANF 288

  Fly   305 DNVVILPHIGSADIETRKEMSRITARNI 332
            .||::..|......|....::..|.:|:
pombe   289 PNVLVTSHQAFFTAEALSAIAHTTLKNV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1236NP_649579.2 GDH 27..338 CDD:240626 82/288 (28%)
LdhA 27..338 CDD:223980 82/288 (28%)
SPAC186.07cNP_595025.1 LdhA 1..332 CDD:223980 82/288 (28%)
LDH_like_2 1..323 CDD:240659 82/288 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53501
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.