DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1236 and SPAC186.02c

DIOPT Version :9

Sequence 1:NP_649579.2 Gene:CG1236 / 40708 FlyBaseID:FBgn0037370 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_595020.1 Gene:SPAC186.02c / 2542495 PomBaseID:SPAC186.02c Length:332 Species:Schizosaccharomyces pombe


Alignment Length:226 Identity:66/226 - (29%)
Similarity:119/226 - (52%) Gaps:10/226 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VAGKDALYCA-LTDKVDKEVLDA-AGPQLKCVATISVGYDHIDVEECRKRGIRVGFTPDVLTDAT 130
            :|||..:.|. :.|:||.:.|.| |...:|.||....||::::::...:..|.|...|.....|.
pombe    41 LAGKAQVVCVFVNDQVDADTLKALAENGVKLVALRCGGYNNVNLKAASEYKITVVHVPSYSPFAV 105

  Fly   131 AELTLALLLATNRRLFEANKQVYNGGWKSWAPMWMCGQGLKGSRVGLLGFGRIGQEIAARI-VPF 194
            :|.|:.|||:.||::..|..:|....:..   :.:.|..:.|..||::|.|:||..:|... :.|
pombe   106 SEFTVGLLLSLNRKIHRAYVRVREDDFNI---VGLLGCDIHGKTVGVIGTGKIGSNVAKCFKMGF 167

  Fly   195 KPTEITYTTRSLRP-KEAAAVNARHVDFDEMLRESDLIVVCCALTPETKEIFNATAFQKMKPNCI 258
            ....:.|   .:.| |:......:.|:.:|:|:::|.:.:.|.|||.|..|.|:.:...||....
pombe   168 GCDVLAY---DINPDKKLENYGVQFVEQNEVLKKADFLCLHCPLTPSTTHIVNSDSLALMKKGVT 229

  Fly   259 LINTARGGVVDQKALYEALKTKRILAAGLDV 289
            ::||:|||::|.|||.:|:.:.::....:||
pombe   230 IVNTSRGGLIDTKALVDAIDSGQVGGCAIDV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1236NP_649579.2 GDH 27..338 CDD:240626 66/226 (29%)
LdhA 27..338 CDD:223980 66/226 (29%)
SPAC186.02cNP_595020.1 LdhA 1..322 CDD:223980 66/226 (29%)
LDH_like_2 1..319 CDD:240659 66/226 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53501
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.