DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1236 and CTBP2

DIOPT Version :9

Sequence 1:NP_649579.2 Gene:CG1236 / 40708 FlyBaseID:FBgn0037370 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_073713.2 Gene:CTBP2 / 1488 HGNCID:2495 Length:985 Species:Homo sapiens


Alignment Length:330 Identity:86/330 - (26%)
Similarity:138/330 - (41%) Gaps:60/330 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PVPRSELIRVVAGKD-------------ALYC--ALTDKVDKEVL-DAAGPQ------------- 93
            |:....|:.::.|:|             ..:|  ..|.::.::|| :|.|..             
Human   569 PLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLE 633

  Fly    94 ----LKCVATISVGYDHIDVEECRKRGIRVGFTPDVLTDATAELTLALLLATNRR---LFEA--- 148
                |:.:..|..|||::|::...:.||.|...|....:.||:.|:..:|...||   |::|   
Human   634 KFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALRE 698

  Fly   149 ---------NKQVYNGGWKSWAPMWMCGQGLKGSRVGLLGFGRIGQEIAARIVPFKPTEITYTTR 204
                     .::|.:|..:           ::|..:||:||||.||.:|.|...|..:.|.|...
Human   699 GTRVQSVEQIREVASGAAR-----------IRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPY 752

  Fly   205 SLRPKEAAAVNARHVDFDEMLRESDLIVVCCALTPETKEIFNATAFQKMKPNCILINTARGGVVD 269
            .....|.:....|.....::|.:||.:.:.|.|......:.|....::|:....|:|.||||:||
Human   753 LQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVD 817

  Fly   270 QKALYEALKTKRILAAGLDVTTPEPLPI-DDPLLKLDNVVILPHIGSADIETRKEMSRITARNIL 333
            :|||.:|||..||..|.|||...||... ..||....|::..||......:...||....|..|.
Human   818 EKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIR 882

  Fly   334 AALAG 338
            .|:.|
Human   883 RAITG 887

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1236NP_649579.2 GDH 27..338 CDD:240626 85/328 (26%)
LdhA 27..338 CDD:223980 85/328 (26%)
CTBP2NP_073713.2 CtBP_dh 574..892 CDD:240624 85/325 (26%)
SerA 590..900 CDD:223189 82/309 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.