DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1236 and Ctbp2

DIOPT Version :9

Sequence 1:NP_649579.2 Gene:CG1236 / 40708 FlyBaseID:FBgn0037370 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001164215.1 Gene:Ctbp2 / 13017 MGIID:1201686 Length:988 Species:Mus musculus


Alignment Length:330 Identity:86/330 - (26%)
Similarity:138/330 - (41%) Gaps:60/330 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PVPRSELIRVVAGKD-------------ALYC--ALTDKVDKEVL-DAAGPQ------------- 93
            |:....|:.::.|:|             ..:|  ..|.::.::|| :|.|..             
Mouse   572 PLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLE 636

  Fly    94 ----LKCVATISVGYDHIDVEECRKRGIRVGFTPDVLTDATAELTLALLLATNRR---LFEA--- 148
                |:.:..|..|||::|::...:.||.|...|....:.||:.|:..:|...||   |::|   
Mouse   637 KFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTVCHILNLYRRNTWLYQALRE 701

  Fly   149 ---------NKQVYNGGWKSWAPMWMCGQGLKGSRVGLLGFGRIGQEIAARIVPFKPTEITYTTR 204
                     .::|.:|..:           ::|..:||:||||.||.:|.|...|..:.|.|...
Mouse   702 GTRVQSVEQIREVASGAAR-----------IRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPY 755

  Fly   205 SLRPKEAAAVNARHVDFDEMLRESDLIVVCCALTPETKEIFNATAFQKMKPNCILINTARGGVVD 269
            .....|.:....|.....::|.:||.:.:.|.|......:.|....::|:....|:|.||||:||
Mouse   756 LQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVD 820

  Fly   270 QKALYEALKTKRILAAGLDVTTPEPLPI-DDPLLKLDNVVILPHIGSADIETRKEMSRITARNIL 333
            :|||.:|||..||..|.|||...||... ..||....|::..||......:...||....|..|.
Mouse   821 EKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIR 885

  Fly   334 AALAG 338
            .|:.|
Mouse   886 RAITG 890

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1236NP_649579.2 GDH 27..338 CDD:240626 85/328 (26%)
LdhA 27..338 CDD:223980 85/328 (26%)
Ctbp2NP_001164215.1 CtBP_dh 577..895 CDD:240624 85/325 (26%)
SerA 593..903 CDD:223189 82/309 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.