DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2100 and AT1G28090

DIOPT Version :9

Sequence 1:NP_001163512.1 Gene:CG2100 / 40707 FlyBaseID:FBgn0037369 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_174130.2 Gene:AT1G28090 / 839702 AraportID:AT1G28090 Length:541 Species:Arabidopsis thaliana


Alignment Length:512 Identity:120/512 - (23%)
Similarity:186/512 - (36%) Gaps:164/512 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FNG-RPQNR-----WLKSMANSMVCSRGVSPELIAQLGKPPRMRTNPAFRKVATPEFKSIFTPEL 76
            |:| |..|:     |.|..||.....|.:.|:               :.|.|            |
plant    68 FSGARGSNKDKSMPWKKLDANEFGIQRSMIPD---------------STRMV------------L 105

  Fly    77 NDLVALFKKYDYELRIAGGAVRDILMGIPPKDIDLATTATPDQMKQMFEKEEVRMINANGEKHGT 141
            |.|    ||..:::.:.||.|||:::...|||.|:.|||         |.:|||.:....:..|.
plant   106 NKL----KKKGFQVYLVGGCVRDLILDRIPKDFDVITTA---------ELKEVRKVFPGCQIVGR 157

  Fly   142 ITPRIN---DKENFEVTTLRIDIRTDGRHAEVMYTTD----------WQLDANRRDLTINS-MFL 192
            ..|..:   |....||::.....|| |:.....:...          |: :..:||.|:|. ||.
plant   158 RFPICHVYVDDIIIEVSSFSTSART-GKAPNKSFRRPAGCDERDYIRWK-NCLQRDFTVNGLMFD 220

  Fly   193 GFDGTVYDYFYGYDDLQERRVVFVGEADIRIKEDFLRILRYFRFYGRIASEENNHDKATLAAIKE 257
            ..:..||||..|.:||:..:|..|..|::...||..||||..|...|:..   :..|....::||
plant   221 PSENVVYDYIGGVEDLRNSKVRTVSAANLSFVEDTARILRAIRIAARLGF---SLTKDVAISVKE 282

  Fly   258 NAKGLARISGERIWSELQKIVP-GNFGAALFLEMHRCNLFEYIGLP-KEPYL--DEFDR------ 312
            .:..|.|:...||..|:..::. |:..|:|.| :.|..|.|.: || :..||  ..|.|      
plant   283 LSSSLLRLDPSRIRMEINYMLAYGSAEASLRL-LWRFGLMEIL-LPIQASYLVSQGFRRRDGRSN 345

  Fly   313 ----LCKALDQFEKPHQP---ILYLAGMLHSVEDAMEMHKRLKLSAYERDLARFITQEREKVGSQ 370
                |.:.||:...|.:|   .|:: |:|       ..||.|            :.|.|:.....
plant   346 MLLSLFRNLDRLVAPDRPCSEFLWI-GIL-------AFHKAL------------VDQPRDPTVVA 390

  Fly   371 YTTLRDYQKLCLQKYI--------------------QRDFVEQLLKYSGK-LELYNQLKSWVKPD 414
            ...|..|.::.|.:.|                    ::|..:...|.|.: ::|...::|     
plant   391 SFCLAIYSEVSLSEAIAIARSNSKQHNSHFQELSSPEKDTADSESKISQQVIKLAESIRS----- 450

  Fly   415 FPIRGNALAQRGLNGMRLGLVMDELKLLWADSDFQLTHDDLLKWIPNVLKKIPSAPG 471
                    |.|.||..                          .:|.|.:.|.|.|||
plant   451 --------AARKLNNR--------------------------DYIANAMSKYPQAPG 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2100NP_001163512.1 PcnB 71..465 CDD:223690 103/445 (23%)
NT_ClassII-CCAase 73..210 CDD:143388 43/150 (29%)
PolyA_pol_RNAbd 248..302 CDD:289399 15/54 (28%)
AT1G28090NP_174130.2 PcnB 91..>398 CDD:223690 93/373 (25%)
NT_ClassII-CCAase 104..238 CDD:143388 44/160 (28%)
PolyA_pol_RNAbd 269..332 CDD:289399 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4205
eggNOG 1 0.900 - - E1_COG0617
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D730946at2759
OrthoFinder 1 1.000 - - FOG0001890
OrthoInspector 1 1.000 - - otm3201
orthoMCL 1 0.900 - - OOG6_103014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1426
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.680

Return to query results.
Submit another query.