DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2100 and LOC100911093

DIOPT Version :9

Sequence 1:NP_001163512.1 Gene:CG2100 / 40707 FlyBaseID:FBgn0037369 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_038957086.1 Gene:LOC100911093 / 100911093 RGDID:6494996 Length:434 Species:Rattus norvegicus


Alignment Length:414 Identity:198/414 - (47%)
Similarity:273/414 - (65%) Gaps:29/414 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KVATPEFKSIFTPELNDLVALFKKYDYELRIAGGAVRDILMGIPPKDIDLATTATPDQMKQMFEK 126
            |:.:|||:|:||..|..|..||.|.::|||||||||||:|.|:.|:|:|.||||||.:||:||:.
  Rat    31 KLQSPEFQSLFTEGLKSLTELFAKENHELRIAGGAVRDLLNGVKPQDVDFATTATPTEMKEMFQA 95

  Fly   127 EEVRMINANGEKHGTITPRINDKENFEVTTLRIDIRTDGRHAEVMYTTDWQLDANRRDLTINSMF 191
            ..:||||..|||||||..|::: |||||||||||:.||||||||.:|||||.||.||||||||||
  Rat    96 AGIRMINNKGEKHGTIIARLHE-ENFEVTTLRIDVSTDGRHAEVEFTTDWQKDAERRDLTINSMF 159

  Fly   192 LGFDGTVYDYFYGYDDLQERRVVFVGEADIRIKEDFLRILRYFRFYGRIASEENNHDKATLAAIK 256
            ||||||::|||.||.||:.::|.|||.|..||:||:|||||||||||||..:..:||:.||.||.
  Rat   160 LGFDGTLFDYFNGYADLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDRETLEAIA 224

  Fly   257 ENAKGLARISGERIWSELQKIVPGNFGAALFLEMHRCNLFEYIGLPKEPYLDEFDRLCKALDQFE 321
            |||||||.|||||||.||:||:.|:....|...::..::..:||||....|:||:::.|.::.|.
  Rat   225 ENAKGLAGISGERIWVELKKILTGDHVNHLIHLIYDLDVASHIGLPANANLEEFNKVSKNVEGFS 289

  Fly   322 KPHQPILYLAGMLHSVEDAMEMHKRLKLSAYERDLARFITQERE---KVGSQYTTLRDYQKLCLQ 383
            .  :|:..||.:....:|..::..|||:|..|::|..||.:.|:   |.......|:.||     
  Rat   290 P--KPMTVLASLFKVQDDVTKLDLRLKISKEEKNLGLFIVKNRKDLIKATDSSEPLKPYQ----- 347

  Fly   384 KYIQRDFVE------------QLLKYSGKLELYNQLKSWVKPDFPIRGNALAQRGL-NGMRLGLV 435
                 |||.            :||||.|:..|..:::.|..|.||:.|:.:.:.|: :|..:|.:
  Rat   348 -----DFVIDSREPDATARVCELLKYQGEHALLKEMQQWSVPPFPVSGHDIRKVGISSGKEIGAL 407

  Fly   436 MDELKLLWADSDFQLTHDDLLKWI 459
            :.:|:..|..|.:|:..|:||.:|
  Rat   408 LQQLREQWKKSGYQMEKDELLNYI 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2100NP_001163512.1 PcnB 71..465 CDD:223690 193/405 (48%)
NT_ClassII-CCAase 73..210 CDD:143388 93/136 (68%)
PolyA_pol_RNAbd 248..302 CDD:289399 27/53 (51%)
LOC100911093XP_038957086.1 PcnB 40..417 CDD:223690 187/389 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9333
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.