DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and prmB

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_416833.4 Gene:prmB / 946805 ECOCYCID:EG12449 Length:310 Species:Escherichia coli


Alignment Length:217 Identity:43/217 - (19%)
Similarity:83/217 - (38%) Gaps:64/217 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 YKHYYGKRIL----------NKDFHDIRLDVLGTQPDLFRNKQLLDIGCNSGHLSIQIARKFEVK 134
            ::.|..:|:|          |..|    ..::..||     :.:||:...||.::|..|..|...
E. coli   102 HEFYVDERVLVPRSPIGELINNKF----AGLISKQP-----QHILDMCTGSGCIAIACAYAFPDA 157

  Fly   135 SLVGLDIDRGLINDAQKTVSHLKRHATPGQGIPHIQFVHGNYVLEDDVLLEIERPQFDVILCLSV 199
            .:..:||....:..|::   :::.|.          .:|....:..|:..::.:.|:|:|    |
E. coli   158 EVDAVDISPDALAVAEQ---NIEEHG----------LIHNVIPIRSDLFRDLPKVQYDLI----V 205

  Fly   200 TKWIHLNFCD-SGLKQAFRRMYLQLRPGGKLILEPQ-----SFDGYKRRKKLSEQIRDNYNAIKF 258
            |...:::..| |.|...:|.             ||:     ..||.|..:::..      ||..:
E. coli   206 TNPPYVDAEDMSDLPNEYRH-------------EPELGLASGTDGLKLTRRILG------NAADY 251

  Fly   259 RPDHFTEYLLSPEVGFAEMKLM 280
            ..|   :.:|..|||.:.:.||
E. coli   252 LAD---DGVLICEVGNSMVHLM 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 22/124 (18%)
Bin3 191..299 CDD:284317 22/96 (23%)
prmBNP_416833.4 PRK11805 1..306 CDD:236988 43/217 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.