DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and HMT1

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_009590.1 Gene:HMT1 / 852322 SGDID:S000000238 Length:348 Species:Saccharomyces cerevisiae


Alignment Length:137 Identity:35/137 - (25%)
Similarity:61/137 - (44%) Gaps:36/137 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 YGNYKHYYGKRILNKDFHDIRL-DVLGT---------QPDLFRNKQLLDIGCNSGHLSIQIARKF 131
            :.:|.||        ..|:..| |.:.|         ..|||::|.:||:||.:|.||: .|.|.
Yeast    24 FNSYDHY--------GIHEEMLQDTVRTLSYRNAIIQNKDLFKDKIVLDVGCGTGILSM-FAAKH 79

  Fly   132 EVKSLVGLDIDRGLINDAQKTVSHLKRHATPGQGIPHIQFVHGNYVLEDDVLLEIERPQFDVILC 196
            ..|.::|:|:..  |.:..|.:..|...:      ..|..:.|.  |||   :.:..|:.|:|  
Yeast    80 GAKHVIGVDMSS--IIEMAKELVELNGFS------DKITLLRGK--LED---VHLPFPKVDII-- 129

  Fly   197 LSVTKWI 203
              :::|:
Yeast   130 --ISEWM 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 25/95 (26%)
Bin3 191..299 CDD:284317 3/13 (23%)
HMT1NP_009590.1 AdoMet_MTases <56..>130 CDD:418430 26/91 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.