DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and AT5G51130

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_568752.1 Gene:AT5G51130 / 835187 AraportID:AT5G51130 Length:318 Species:Arabidopsis thaliana


Alignment Length:345 Identity:106/345 - (30%)
Similarity:164/345 - (47%) Gaps:79/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DLENNNNTPLTGKQAEKCAKKRKCVITLDEKQVESKRLKKEESNVEATSRPPAQSPKKRLHLNGK 66
            |.:.|........:.||..:|    :..:|::|.:::.:|::...:....   ||.||:      
plant     6 DQKKNKKKRNRSNENEKSVEK----VVANEEKVPTQQKQKQQQGQQGNCN---QSKKKK------ 57

  Fly    67 PMQNKDLNFKYGNYKHYYGKRILNKDFHDIRLDVLGTQPDLFRNKQLLDIGCNSGHLSIQIARKF 131
               |::: :.:|||::|||.||.|....|.||.||  :.:.|..|..||||||||.::|.||:||
plant    58 ---NQEV-YPFGNYRNYYGYRISNDTDEDPRLKVL--KKEWFEGKDCLDIGCNSGIMTIHIAKKF 116

  Fly   132 EVKSLVGLDIDRGLINDA-----------QKTVSHLKRHATPGQGIPH----------------- 168
            ..:|::|:|||...|.||           ..|....|:.::.|....|                 
plant   117 GCRSILGVDIDTSRIEDAHWHLRKFVRMQNSTKPSEKKSSSEGADGVHGSKEPSVSLSNGEAKAD 181

  Fly   169 ----------IQFVHGNYV----LEDDVLLEIERPQFDVILCLSVTKWIHLNFCDSGLKQAFRRM 219
                      :.|...|:|    |:|:        ::|.|||||||||:|||:.|.||...|.::
plant   182 SAETKDLSQIVSFQKENFVQTRNLDDN--------RYDTILCLSVTKWVHLNWGDDGLITLFSKI 238

  Fly   220 YLQLRPGGKLILEPQSFDGYKRRKKLSEQIRDNYNAIKFRPDHFTEYLLSPEVGFAEMK-----L 279
            :..|:|||..::|||.:..|:..:::||....||..|..|||.|.|.||. ::||..::     |
plant   239 WRLLQPGGIFVMEPQPWKSYENNRRVSETTAMNYRTIVLRPDRFQEILLD-KIGFRTVEDLTSSL 302

  Fly   280 MGIPEHCKVGFKRPIQIFTK 299
            .|..:    ||.|.|..|.|
plant   303 SGASK----GFDRQILAFQK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 52/165 (32%)
Bin3 191..299 CDD:284317 46/112 (41%)
AT5G51130NP_568752.1 Methyltransf_25 99..246 CDD:404528 49/154 (32%)
Bin3 210..318 CDD:399683 46/112 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2751
eggNOG 1 0.900 - - E1_KOG2899
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I1774
OMA 1 1.010 - - QHG55475
OrthoDB 1 1.010 - - D1185441at2759
OrthoFinder 1 1.000 - - FOG0003359
OrthoInspector 1 1.000 - - otm3386
orthoMCL 1 0.900 - - OOG6_103556
Panther 1 1.100 - - O PTHR12315
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.