DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and lyn

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001004543.1 Gene:lyn / 447804 ZFINID:ZDB-GENE-040912-7 Length:510 Species:Danio rerio


Alignment Length:183 Identity:41/183 - (22%)
Similarity:70/183 - (38%) Gaps:45/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 NSGHLSIQIARKFEVKSLVGLDI---------DRGLINDAQKTVSHLKRH---------ATPGQG 165
            |:|.|..|:.:|.|.|..:.:.:         |.|.....:..:  ::.|         .|..:|
Zfish    47 NAGLLPGQVFQKMEEKEKIVVALYPYEAIHADDLGFKKGEKLKI--IEEHGEWWKARSLTTRKEG 109

  Fly   166 IPHIQFVHGNYVLEDDVLLEIERPQFDVILCLSVTKWIHLNFCDSGLKQAFRRMYLQL-RPGGKL 229
                 |:..|||.|.|. :|.|             :|.   :.|...|.|.|::.... :||..|
Zfish   110 -----FIPSNYVAEADT-METE-------------EWF---YKDITRKDAERQLLAPANKPGSYL 152

  Fly   230 ILEPQSFDG-YKRR-KKLSEQIRDNYNAIKFRPDHFTEYLLSPEVGFAEMKLM 280
            |.|.::..| |... :.:..|.:|.....|.|......|.:||::.|:::..|
Zfish   153 IRESETSKGSYSLSIRDVDAQGQDVVKHYKIRSLDNGGYYISPKITFSDISSM 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 29/132 (22%)
Bin3 191..299 CDD:284317 21/93 (23%)
lynNP_001004543.1 SH3_Lyn 65..120 CDD:212937 10/61 (16%)
SH2_Src_Lyn 123..223 CDD:198227 23/99 (23%)
PTKc_Lyn 237..508 CDD:270657
Pkinase_Tyr 245..495 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.