DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and CG11342

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_647896.1 Gene:CG11342 / 38538 FlyBaseID:FBgn0035537 Length:238 Species:Drosophila melanogaster


Alignment Length:219 Identity:67/219 - (30%)
Similarity:100/219 - (45%) Gaps:59/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KYGNYKHYY-----GKRILNKDFHDIRLDVL---GTQPDLFRNKQLLDIGCNSGHLSIQIARKF- 131
            :|||:.:||     .:|:......||.|..|   .||.|  :...:||:|||.|.|: |:..|: 
  Fly    12 QYGNFFNYYQFSSAAERVKLLPDADIWLPALEDGETQKD--KPYFILDVGCNCGVLT-QLMHKYL 73

  Fly   132 ------EVKSLVGLDIDRGLI------NDAQKTVSHLKRHATPGQGIPHIQFVHGNYVLEDDVL- 183
                  .|| ::|:|||..||      |::.|.||:....                 ||:|:.. 
  Fly    74 EERLHRSVK-VLGVDIDPRLIQRASEENESPKDVSYACVD-----------------VLDDEAFE 120

  Fly   184 -----LEIER-PQFDVILCLSVTKWIHLNFCDSGLKQAFRRMYLQ--LRPGGKLILEPQSFDGY- 239
                 :|:.. .:||.|.|.|:|.|||||..|.||     |.:||  ......|::|||.:..| 
  Fly   121 SVKTYMEVNNLEKFDAICCYSITMWIHLNHHDQGL-----RFFLQKLSNLAELLVVEPQPWKCYQ 180

  Fly   240 --KRRKKLSEQIRDNYNAIKFRPD 261
              :||.|.:.:|...:..:|:|.|
  Fly   181 KAERRLKKAGEIFPLFLELKWRSD 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 43/145 (30%)
Bin3 191..299 CDD:284317 29/76 (38%)
CG11342NP_647896.1 Methyltransf_12 56..165 CDD:285454 42/132 (32%)
AdoMet_MTases 134..238 CDD:302624 29/76 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459124
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2899
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185441at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12315
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.