DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and AgaP_AGAP010535

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_314502.4 Gene:AgaP_AGAP010535 / 1275264 VectorBaseID:AGAP010535 Length:266 Species:Anopheles gambiae


Alignment Length:203 Identity:42/203 - (20%)
Similarity:71/203 - (34%) Gaps:48/203 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DLFRNKQLLDIGCNSGHLSIQIARKFEVKSLVGLDIDRGLINDAQKTVSHLKRHATPGQGI---- 166
            |..:...:||:||..|..:..:|:..  .::||:|..|.||..|       |.||.....|    
Mosquito    76 DALKGLNILDVGCGGGIYAEALAKLH--ANVVGIDPARHLIEVA-------KAHAEAQSDIKDRC 131

  Fly   167 --------PHIQFVHGNYVLEDDVLLEIERPQFDVILCLSVTKWIHLNFCDSGLKQAFRRMYLQL 223
                    .|.|.....|               ||::.....:  |:....|.||....    .|
Mosquito   132 HYYEQSMEEHWQGAANKY---------------DVVVLSETIE--HVVDKSSLLKHVAE----VL 175

  Fly   224 RPGGKLILEPQSFDGYKRRKKLSEQIRDNYNAIKFRPDHFTEYLLSPEVGFAEMKLMGIPEHCKV 288
            :|||.:.:...:...:.  ..|:..:.:|......:..|..:..:|||...|.::..|    |:.
Mosquito   176 KPGGSVFISTWNKTSWS--WLLAVVVLENIMKRLPKGSHDYDKFVSPEETEAILEAYG----CRT 234

  Fly   289 GFKRPIQI 296
            ..:||..:
Mosquito   235 IEQRPFYL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 30/135 (22%)
Bin3 191..299 CDD:284317 21/106 (20%)
AgaP_AGAP010535XP_314502.4 UbiG 26..259 CDD:273910 42/203 (21%)
Methyltransf_23 78..236 CDD:290224 39/193 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.