DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and AgaP_AGAP000172

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_310965.5 Gene:AgaP_AGAP000172 / 1272091 VectorBaseID:AGAP000172 Length:216 Species:Anopheles gambiae


Alignment Length:155 Identity:35/155 - (22%)
Similarity:64/155 - (41%) Gaps:30/155 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KQLLDIGCNSGHLSIQIARKFEVKSLVGLDIDRGLINDAQKTVSHLKRHATPGQGIPHIQFVHGN 175
            :.:||:||..|.|||. |.......:||::||...|...:......:        :.::|.|..:
Mosquito    53 RTVLDLGCGPGMLSIG-AALLGADLVVGVEIDPDAIEVFRSNCDEFE--------LENVQCVQAD 108

  Fly   176 YVLEDDVLLEIERPQFDVILCLSVTKWIHLN-----FCDSGLKQAFRRMYLQLRPGGKLILEPQS 235
            .:...::..:.:|| ||.:|         ||     ..:||...||.::.:.|..|....|...:
Mosquito   109 VLRLPEIFADRQRP-FDTVL---------LNPPFGTKQNSGADMAFLKVAITLARGAVYSLHKSA 163

  Fly   236 FDGYKRRKKLSEQIRDN------YN 254
            ...:.::|.|..::|.:      ||
Mosquito   164 TREHVKKKALEWKVRPSLIAELRYN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 30/126 (24%)
Bin3 191..299 CDD:284317 17/75 (23%)
AgaP_AGAP000172XP_310965.5 COG2263 7..211 CDD:225172 35/155 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.