DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and tgs1

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_003197913.2 Gene:tgs1 / 100537552 ZFINID:ZDB-GENE-070802-2 Length:800 Species:Danio rerio


Alignment Length:182 Identity:39/182 - (21%)
Similarity:67/182 - (36%) Gaps:58/182 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TGKQAEKCAKKRKCVITLDEKQVESKRLKKEESNVEATSRPPAQSPKKRLHLNGKPMQNKDLNFK 76
            |.|::.:..||.|            ::.:|...:||   .||..:.:..|             .|
Zfish   563 TKKESVQAFKKNK------------RKKRKRRKDVE---MPPEIAAEPEL-------------AK 599

  Fly    77 YGNYKHYYGKRILNKDFHDIRLDVLG---TQP------------DLFRNKQLLDIGCNSGHLSIQ 126
            |...::    |:.::....|:||..|   ..|            |.|..:.::|..|..|..:||
Zfish   600 YWAQRY----RLFSRFDEGIKLDHEGWFSVTPEKIAEHIALRVQDCFNTELIIDAFCGVGGNAIQ 660

  Fly   127 IARKFEVKSLVGLDIDRGLINDAQKTVSHLKRHATPGQGI-PHIQFVHGNYV 177
            .|  ...|.::|:|||...:..||        |.....|: ..|.|:.|:::
Zfish   661 FA--LTGKRVIGIDIDPVRLALAQ--------HNAAVYGVEQRIDFLQGDFL 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 18/70 (26%)
Bin3 191..299 CDD:284317
tgs1XP_003197913.2 Methyltransf_15 645..796 CDD:286524 18/68 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.