DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and bcdin3d

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_002935777.1 Gene:bcdin3d / 100489630 XenbaseID:XB-GENE-5859380 Length:257 Species:Xenopus tropicalis


Alignment Length:230 Identity:61/230 - (26%)
Similarity:87/230 - (37%) Gaps:74/230 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 YGNYKHYY------------GKRILNKDFHDIRLDVLGTQPDLFRNKQL-LDIGCNSGHLSIQIA 128
            |||:.:||            ...:|.|.|..      .|:.|......| ||:|||||.||:.:.
 Frog    17 YGNFPNYYTFNPPENRISLLPAELLQKLFRK------PTESDRCARPLLGLDVGCNSGDLSVALY 75

  Fly   129 RKF-----------EVKSLVGLDIDRGLINDAQKTVSHLKRHATPGQGIPHIQFVHGNYVLED-- 180
            ...           :....:..|||..||..||.:             .|...|:  :|...|  
 Frog    76 NHLMQPCSQASDVPQALRFLCCDIDPDLITRAQAS-------------NPFPDFI--SYATLDIM 125

  Fly   181 ----------DVLLEIERPQFDVILCLSVTKWIHLNFCDSGLKQAFRRM-----YLQLRPGGKLI 230
                      |.|.:.....||:..|:|||.|||||:.|.||.....|:     |        |:
 Frog   126 DSLAVQGPVKDFLQQFGCSTFDITFCMSVTMWIHLNYGDQGLVTFLGRLANLSEY--------LL 182

  Fly   231 LEPQSFDGY----KRRKKLSEQIRDNYNAIKFRPD 261
            :|||.:..|    :|.:||..|..|::.::..|.|
 Frog   183 IEPQPWKCYRLAARRLRKLGRQDFDHFRSLSIRGD 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 40/152 (26%)
Bin3 191..299 CDD:284317 28/80 (35%)
bcdin3dXP_002935777.1 AdoMet_MTases 61..177 CDD:388410 37/130 (28%)
Bin3 146..251 CDD:369112 28/80 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185441at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.