DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and henmt1

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001153012.1 Gene:henmt1 / 100286818 XenbaseID:XB-GENE-998999 Length:369 Species:Xenopus tropicalis


Alignment Length:217 Identity:52/217 - (23%)
Similarity:94/217 - (43%) Gaps:49/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DLFRNKQLLDIGCNSGHLSIQIARKFE-VKSLVGLDIDRGLINDAQKTVSHLKRH-ATPGQGIPH 168
            |.::.|::.|:||::..| :...|.:: :|.|||||||..:::..:.|::.|..| ..|......
 Frog    23 DTYKPKKVADLGCSTCSL-LHTLRFWDCIKVLVGLDIDEDVLSRKKFTLTPLPAHYLEPRNTSLT 86

  Fly   169 IQFVHGNYVLEDDVLLEIERPQFDVILCLSVTKWIHLNFCDSGLKQAFRR-MYLQLRPGGKLILE 232
            |....|:...:|..||     .||:|.|:.:.:  ||   ::...:.||. ::..:.|...:|..
 Frog    87 INLYQGSVTQKDPALL-----GFDLITCIELIE--HL---EAEELENFREVLFGFMAPITVIIST 141

  Fly   233 PQSFDGYKRRKKLSEQIRDNYNAI-----KFR-PDHFTEYLLSPEVGFA---------EMKLMGI 282
            |.:                .:|.:     .|| |||..|:.......:|         .:::.|:
 Frog   142 PNA----------------EFNILFPKCTGFRHPDHKFEWNRREFQSWATEVAKCFNYTVEITGV 190

  Fly   283 ---PEHCK-VGFKRPIQIFTKS 300
               |...| |||...|.:||::
 Frog   191 GEPPRDSKNVGFCSQIAVFTRN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 33/126 (26%)
Bin3 191..299 CDD:284317 27/127 (21%)
henmt1NP_001153012.1 bacter_Hen1 <7..211 CDD:274962 51/214 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.