DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and mepceb

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_001921729.2 Gene:mepceb / 100151157 ZFINID:ZDB-GENE-110411-13 Length:629 Species:Danio rerio


Alignment Length:336 Identity:103/336 - (30%)
Similarity:166/336 - (49%) Gaps:80/336 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KRLKKEESNVEATSRPPAQSPKKRL-------H------LNGKP--------MQNKDLNFKY--G 78
            :.:.:.:|.:..|..||.    |||       |      .:|.|        .|.:....||  |
Zfish   296 RTVSRSDSRLSITPTPPT----KRLITHTQTFHTPVIGGASGAPPLGAERSHEQQRRPRRKYHNG 356

  Fly    79 NYKHYYGKRILNKDFHDIRLDVLGTQPDLFRNKQLLDIGCNSGHLSIQIARKFEVKSLVGLDIDR 143
            .|..|||.|..:.. .|.||.:.  .|:.|..|::||:|||:||:::.||:......::|||||.
Zfish   357 AYSRYYGYRTPSMT-ADPRLALF--NPEWFSGKKVLDVGCNTGHVTLAIAKHCSPAHILGLDIDG 418

  Fly   144 GLINDAQKTVSHL------KRHATPGQG------IP----------------------------- 167
            .|:..|::.:.|.      ::.|..|:|      :|                             
Zfish   419 ALVQAARQNLRHFLSELQDRQQAGAGEGSEVTGLVPLMDLQLVLPRFPVSFMRCRGPIAAPPIMH 483

  Fly   168 --------HIQFVHGNYVLEDDVLLEIERPQFDVILCLSVTKWIHLNFCDSGLKQAFRRMYLQLR 224
                    ::.|:.|:||.:.|..:..:..::|||||||:|||:|||:.|:|:::.|.|:|..|.
Zfish   484 QSLGQFPSNVCFLKGDYVPDSDAEVVSQSAEYDVILCLSLTKWVHLNYGDAGIQRLFGRIYRHLL 548

  Fly   225 PGGKLILEPQSFDGYKRRKKLSEQIRDNYNAIKFRPDHFTEYLLSPEVGFAEMKLMGIPEHCKVG 289
            |||.||||||.:..|.|.|:|::..|.||::|:.:||.|:.:|:: ||||:..:|:|.|.....|
Zfish   549 PGGVLILEPQPWSSYSRHKRLTDVTRRNYSSIRLKPDKFSSFLMA-EVGFSSYELIGTPRASPKG 612

  Fly   290 FKRPIQIFTKS 300
            .:|.:.:|.||
Zfish   613 LQRSVYLFHKS 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 52/172 (30%)
Bin3 191..299 CDD:284317 50/107 (47%)
mepcebXP_001921729.2 Methyltransf_18 384..557 CDD:289607 52/172 (30%)
Bin3 515..622 CDD:284317 50/107 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589284
Domainoid 1 1.000 124 1.000 Domainoid score I5449
eggNOG 1 0.900 - - E1_KOG2899
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185441at2759
OrthoFinder 1 1.000 - - FOG0003359
OrthoInspector 1 1.000 - - otm24354
orthoMCL 1 0.900 - - OOG6_103556
Panther 1 1.100 - - O PTHR12315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2424
SonicParanoid 1 1.000 - - X2246
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.