DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and pmt

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001096276.2 Gene:pmt / 100124841 XenbaseID:XB-GENE-5904605 Length:494 Species:Xenopus tropicalis


Alignment Length:216 Identity:49/216 - (22%)
Similarity:92/216 - (42%) Gaps:58/216 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 YKHYYGKRILN-------KDFHDIRLDVLGTQPDLFRNKQLLDIGCNSGHLSIQIARKFEVKSLV 137
            |:..:|:..::       |:|    :.:|..:|    .::::|:||..|.....:|:.:.|: ::
 Frog   251 YEKIFGEGFVSTGGLETTKEF----ISMLNLRP----GQRVVDVGCGIGGGDFYMAKTYGVE-VL 306

  Fly   138 GLDIDRGLINDAQKTVSHLKRHATPGQGIPHIQFVHGNYVLEDDVLLEIERPQFDVILCLSVTKW 202
            |:|:...::..|.:.....|        ||.:||..|     |..........|||:  .|....
 Frog   307 GMDLSSNMVEIAMERAIIEK--------IPLVQFEIG-----DATKRSFSEASFDVV--YSRDTI 356

  Fly   203 IHLNFCDSGLKQA-FRRMYLQLRPGGKLIL-------EPQS--FDGYKRRKKLSEQIRDNYNAIK 257
            :|:|.     |:| |||.|..|:|||||::       .|.|  |..|.:::          ..|.
 Frog   357 LHIND-----KEALFRRFYTWLKPGGKLLITDYCCGERPWSPVFQEYVKQR----------GYIL 406

  Fly   258 FRPDHFTEYLLSPEVGFAEMK 278
            :.|..:.::|  .:.||..::
 Frog   407 YTPQEYGQFL--EKAGFVNVQ 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 34/131 (26%)
Bin3 191..299 CDD:284317 27/98 (28%)
pmtNP_001096276.2 PLN02336 14..488 CDD:177970 49/216 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.