DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1239 and siah2

DIOPT Version :9

Sequence 1:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001095281.1 Gene:siah2 / 100124319 XenbaseID:XB-GENE-1004950 Length:318 Species:Xenopus tropicalis


Alignment Length:102 Identity:19/102 - (18%)
Similarity:38/102 - (37%) Gaps:38/102 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 RGLINDAQKTVSHLKRHATPGQGIPHIQFVHGNYVLEDDVLL--EIERPQFDVILCLSVTKWIHL 205
            :|.:.:..:.::|..:..|..||             ||.|.|  :|..|        ....|:.:
 Frog   172 QGSLENVMQHLTHSHKSITTLQG-------------EDIVFLATDINLP--------GAVDWVMM 215

  Fly   206 NFCDSGLKQAFRRMYLQLRPGGKLILEPQ-SFDGYKR 241
            .:|       |...::       |:||.| .::|:::
 Frog   216 QYC-------FNHHFM-------LVLEKQEKYEGHQQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 16/91 (18%)
Bin3 191..299 CDD:284317 8/52 (15%)
siah2NP_001095281.1 RING_Ubox 72..109 CDD:418438
Sina 116..312 CDD:397316 19/102 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.