DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment plx and AT3G02460

DIOPT Version :9

Sequence 1:NP_001163511.1 Gene:plx / 40704 FlyBaseID:FBgn0261261 Length:1572 Species:Drosophila melanogaster
Sequence 2:NP_566172.1 Gene:AT3G02460 / 821261 AraportID:AT3G02460 Length:353 Species:Arabidopsis thaliana


Alignment Length:312 Identity:99/312 - (31%)
Similarity:159/312 - (50%) Gaps:34/312 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   902 DKQLIERWEQIIERNSTQIGN-------KKDPKVLGHAIRTGVPRSKRGDVWTFLAEQHS---MN 956
            :::.:.:|.::|     .:|.       ::.|.|:...||.|:|...||.||..::....   ||
plant    52 EERKVRKWRKMI-----GVGGSDWKHYVRRKPNVVRRRIRKGIPDCLRGLVWQLISGSRDLLLMN 111

  Fly   957 TAPVDTKRFPNFNTPYHMLLKHLTEHQHA-IFIDLGRTFPNHQFYKDPLGLGQLSLFNLLKAYSI 1020
            ..            .|..|:.:.|..... |..|:.||||:|.|::...|.||.||:|:|||||:
plant   112 PG------------VYEQLVIYETSASELDIIRDISRTFPSHVFFQKRHGPGQRSLYNVLKAYSV 164

  Fly  1021 LDPELGYCQGLGFICGVLLLHCDEANSFQLLKHLM---FRRNMRTKYLPDMKKFQLQLYQLSRLV 1082
            .|.::||.||:|||.|:|||:..|.::|.||..|:   ....|...|...:...|..|:||..||
plant   165 YDRDVGYVQGMGFIAGLLLLYMSEEDAFWLLVALLKGAVHAPMEGLYHAGLPLVQQYLFQLESLV 229

  Fly  1083 KDHLPDLYVWLDQNDVSPTLYAAPWILTVFSSQFPLGFVARVFDLLFLESSDVIFKFAIALLSVH 1147
            |:.:|.|.....|..::|::||:.|.:||||..||.....|::|:...|...::||..:|||. :
plant   230 KELIPKLGEHFTQEMINPSMYASQWFITVFSYSFPFPLALRIWDVFLSEGVKIVFKVGLALLK-Y 293

  Fly  1148 KQQLLAKDNFEEIMDYLKTVVPKMEHTCMEQIMKLVFSMDIGKQLAEYKVEY 1199
            .|..|.|..||:::..|||......:.  :.::.|.:|:.:.|:|.|..:||
plant   294 CQDELVKLPFEKLIHALKTFPEDAMNP--DTLLPLAYSIKVSKRLEELTLEY 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
plxNP_001163511.1 PTB_TBC1D1_like 301..601 CDD:269967
DUF3350 835..880 CDD:288663
TBC 933..1152 CDD:214540 80/225 (36%)
RILP-like <1176..1267 CDD:304877 7/24 (29%)
AT3G02460NP_566172.1 TBC 85..299 CDD:214540 80/226 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.