DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment plx and CG5916

DIOPT Version :9

Sequence 1:NP_001163511.1 Gene:plx / 40704 FlyBaseID:FBgn0261261 Length:1572 Species:Drosophila melanogaster
Sequence 2:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster


Alignment Length:306 Identity:82/306 - (26%)
Similarity:147/306 - (48%) Gaps:50/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   908 RWEQIIERNS--TQIGNKKDPKVLGHAIRTGVPRSKRGDVWTFLAEQHSMNTAPVDTKRFPNFNT 970
            :||.|:::|:  ||:..|     |...||.|:|...|.|||.      .::.|....:|.|:   
  Fly    45 KWEAILQQNTDLTQVDAK-----LKRYIRKGIPGPYRPDVWM------KISGAAAAQRRSPD--- 95

  Fly   971 PYHMLLKHL-------TEHQHAIFIDLGRTFPNHQFYKDPLGLGQLSLFNLLKAYSILDPELGYC 1028
                |.::|       .|...:|.|||.||||::..:    .:.:..|:|:|.||:..:.::|||
  Fly    96 ----LFRNLLRTEPFDKEISDSISIDLPRTFPDNIHF----DMKKQRLYNILIAYAHHNRDVGYC 152

  Fly  1029 QGLGFICGVLLLHC-DEANSFQLLKHLMFRRNMRTKY--------LPDMKKFQLQLYQLSRLVKD 1084
            |||.:|.|:||:.. ||..||.||||::  .|:..:|        |.|:..|:       .||..
  Fly   153 QGLNYIAGLLLIVTDDEEKSFWLLKHIV--ENIVPQYHSHNMANLLRDLAVFR-------ELVIR 208

  Fly  1085 HLPDLYVWLDQNDVSPTLYAAPWILTVFSSQFPLGFVARVFDLLFLESSDVIFKFAIALLSVHKQ 1149
            .:|.:...:|...:...:.|:.|.:.:|:...|:..|.|::|.:|.|...::|:.|:.:...||.
  Fly   209 RIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKN 273

  Fly  1150 QLLAKDNFEEIMDYLK-TVVPKMEHTCMEQIMKLVFSMDIGKQLAE 1194
            .:|..|:...:.:..: |::.....|.....::.:||:.:.:...|
  Fly   274 AILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSLRLKRSELE 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
plxNP_001163511.1 PTB_TBC1D1_like 301..601 CDD:269967
DUF3350 835..880 CDD:288663
TBC 933..1152 CDD:214540 67/234 (29%)
RILP-like <1176..1267 CDD:304877 3/19 (16%)
CG5916NP_001287357.1 TBC 67..276 CDD:214540 67/234 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.