DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment plx and wkd

DIOPT Version :9

Sequence 1:NP_001163511.1 Gene:plx / 40704 FlyBaseID:FBgn0261261 Length:1572 Species:Drosophila melanogaster
Sequence 2:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster


Alignment Length:372 Identity:93/372 - (25%)
Similarity:158/372 - (42%) Gaps:80/372 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   893 LDYEEIVPCDKQ---LIERWEQIIERNSTQIGNKKDPKVLGHAIRTGVPRSKRGDVWTFLAEQHS 954
            |...:|:..:|:   :|:.|...:.:|..:|.::         .|.|:|:|.|...|.:|:..:.
  Fly    40 LSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDR---------CRKGIPKSVRPKAWFYLSGAYL 95

  Fly   955 MNTAPVDTKRFPNFNTPYHMLL---------KHLTEHQHAIFIDLGRTFPNHQFYKDPLGLGQLS 1010
            :.      |:.||.   |:.||         :.:.:.:|       |.||.|:.:.|...:||:.
  Fly    96 LK------KKNPNV---YNELLEKPGNPTTIEEIKKDKH-------RQFPFHEMFLDEQKVGQIE 144

  Fly  1011 LFNLLKAYSILDPELGYCQGLGFICGVLLLHCDEANSFQLLKHL--MFRRNMRTKYLPDMKKFQL 1073
            |||:||||||.:|::|:||....|...||:|....::|.:...:  ::   ::..::|.::..|.
  Fly   145 LFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVY---LQDYFIPGLEVIQN 206

  Fly  1074 QLYQLSRLVKDHLPDLYVWLDQNDVSPTLYAAPWILTVFSSQFPLGFVARVFDLLFLESSDVIFK 1138
            ....|..|:|...|.:|..|.::.|.|.||...|.|...:...|...:.||:|....|...||||
  Fly   207 DAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFK 271

  Fly  1139 FAI----ALLSVHKQQLLAKDNFEEIMDYLKTVVPKMEHTCMEQIMKLVFSMDIGKQLAEYK-VE 1198
            .|:    |.||.|                      |:..||          ..:.:.||..: .|
  Fly   272 VALVIIGASLSRH----------------------KVRKTC----------TGLCETLAVLRSPE 304

  Fly  1199 YNVLQEEITTTNHHLEMLNREKTQNQHLEQQLQFAQSSIAQLETTRS 1245
            .::::||....|.....|..|..|.:|..|:.:.|:.. ||.|...|
  Fly   305 EHIVEEEFIINNMMRLNLRVEDFQIEHTRQKARRAKQK-AQQEAESS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
plxNP_001163511.1 PTB_TBC1D1_like 301..601 CDD:269967
DUF3350 835..880 CDD:288663
TBC 933..1152 CDD:214540 67/233 (29%)
RILP-like <1176..1267 CDD:304877 16/71 (23%)
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 50/172 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.