DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment plx and RN-tre

DIOPT Version :9

Sequence 1:NP_001163511.1 Gene:plx / 40704 FlyBaseID:FBgn0261261 Length:1572 Species:Drosophila melanogaster
Sequence 2:NP_652381.1 Gene:RN-tre / 36554 FlyBaseID:FBgn0020620 Length:571 Species:Drosophila melanogaster


Alignment Length:596 Identity:125/596 - (20%)
Similarity:231/596 - (38%) Gaps:156/596 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   873 ETENAMLQARQNENE--LKRIKLDYEEIVPCDKQLIERWE------------------------- 910
            |.:.|:::..::|.|  .:|.:|..:     ...:::.||                         
  Fly     5 EQQEALVKRAEDEREDIFRRYELGLD-----PSNVVDSWENPTFEIYHRTDKYGFLHDSRLPSTR 64

  Fly   911 --QIIERNSTQI-GNKKDPKVLGH----------AIRTGVPRSKRGDVWTFLAE-QHSMNTAPVD 961
              |.:.||..:: .:||..|:|..          .:..|:|...|...|..|.: |.|:|.    
  Fly    65 DAQEVHRNKIEMERDKKWMKMLNQWPPPQDKLHKRVYKGIPDRVRMVAWNKLLDIQQSINN---- 125

  Fly   962 TKRFPNFNTPYHML---LKHLTEHQHAIFIDLGRTFPNHQFYKDPLGLGQLSLFNLLKAYSILDP 1023
                 |......||   .|:.||.:. |..|:.|.|.::..:::...:.|.||||:|.||||.:.
  Fly   126 -----NAGVYLRMLQLARKYSTETRQ-IDADVNRQFRDNLAFRERYSVKQCSLFNVLNAYSIYNS 184

  Fly  1024 ELGYCQGLGFICGVLLLHCDEANSFQLLKHLMF--RRNMRTKYLPDMKKFQLQLYQLSRLVKDHL 1086
            |||||||:..:.|||||:..|..:|..|..|:.  :..|...::....|....:....|::...:
  Fly   185 ELGYCQGMACVAGVLLLYLHEEEAFWALNTLITDQKYGMHGLFIEGFPKLTRFIDHHDRIMSKIM 249

  Fly  1087 PDLYVWLDQNDVSPTLYAAPWILTVFSSQFPLGFVARVFDLLFLESSDVIFKFAIALLSVHKQQL 1151
            ..|:....:::|...|||..|...||..:.|.....||:|:..|:...||...||.:|.:||.:|
  Fly   250 RKLHKHFTKHNVDALLYAIKWFFVVFVERVPFSLSLRVWDIFMLDGDRVILSMAITILYLHKDEL 314

  Fly  1152 LAKDNFEEIMDYLKTVVPKM-------EHTCMEQIMKLVFSM----------------------- 1186
            |...:.:.|::||:..:.|.       ....:|::||.:..:                       
  Fly   315 LRLKDMDAIIEYLQVRLHKNFGYSDDDAIQALERVMKKLKDLKLDVPPPAKSNEFPTRKLGDFVE 379

  Fly  1187 -DIGKQLAEYKVEYNVLQEEITTTNHHLEMLNREKTQNQHLEQQLQFAQS--------------S 1236
             |:.|::...:.:|...::::.|     ::::|::.....::..:.:..|              |
  Fly   380 ADMEKKIGRRRNDYTDAEKQVIT-----DVISRQEQNAIDVQSTVSYETSECATGDGYSMKTFES 439

  Fly  1237 IAQLETTRSSQQAQ-------ITTLQS-QVQSLELTIQTLGRYVGQLVEHNPDLELPNEVRRMLQ 1293
            |..|.|:.::....       :||:.| |..:...:|..|     ..::.:|.|. ||.::.|..
  Fly   440 ITSLATSPANSSYSLYSNGFVVTTIDSEQDPARSQSIHNL-----SYLQTHPALP-PNGLQHMRH 498

  Fly  1294 QL-DDLDRQRRKPIFTERKIGKSVSVNSHLGFPLKVLEELTERDELGSPQKQKKEKTPFFEQLRQ 1357
            .. .|.|.:.|            :.::..|        |:.:|.:|....|....:..:..|   
  Fly   499 SFSSDSDSRNR------------IDLDQAL--------EVLQRQQLPLHPKTPSSQVVYIVQ--- 540

  Fly  1358 QQQQHRLNGGG 1368
                   ||||
  Fly   541 -------NGGG 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
plxNP_001163511.1 PTB_TBC1D1_like 301..601 CDD:269967
DUF3350 835..880 CDD:288663 2/6 (33%)
TBC 933..1152 CDD:214540 67/224 (30%)
RILP-like <1176..1267 CDD:304877 18/136 (13%)
RN-treNP_652381.1 TBC 100..315 CDD:214540 67/224 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.