DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment plx and CG3703

DIOPT Version :9

Sequence 1:NP_001163511.1 Gene:plx / 40704 FlyBaseID:FBgn0261261 Length:1572 Species:Drosophila melanogaster
Sequence 2:NP_569874.1 Gene:CG3703 / 31045 FlyBaseID:FBgn0040348 Length:711 Species:Drosophila melanogaster


Alignment Length:463 Identity:93/463 - (20%)
Similarity:145/463 - (31%) Gaps:157/463 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HKPQAKSIGNGFLQLKSSAGQTSSSSAVASSMGGAASSSLTGNGL--RHTLTASTSYGSLSSSAA 138
            |.|.::.|    .||||   |.:....:|...|..        |:  :|.|.....:  :.....
  Fly   168 HGPDSQLI----QQLKS---QLTELEQIAYEAGEP--------GILPQHVLLEKQKF--ILDELR 215

  Fly   139 CAYQLQLQQ------SAEASAEQPQNFM-EFQGPITGLVYLLKDPKDPLLHIYLF----ECEAVE 192
            ....||::|      |.|....|..|.: ||.||:.....|:...|..:..:..|    :|:|:|
  Fly   216 AKLNLQVEQHELPALSTEQLRHQVDNAIGEFVGPLKMKEQLVAQLKTQITDLERFIAFLQCDAIE 280

  Fly   193 EMAELMHQMRDPAHTLGGSVGSIPQTLIGGGGGSHGNSNGALNGIHA-TPATNLKMSEAMRNAQH 256
                             ||||...:.|           :||.|...| ..|.:.:.|....||..
  Fly   281 -----------------GSVGDRLKLL-----------SGAYNSYAAKQTARSSQASYVATNAPA 317

  Fly   257 DTSPNPVSSKMKASK------SYTHGLSSSSGTVNIPTSTSAQSNLSLLADISPNHTHFFEVMYV 315
            .|:..|.||.:.|..      |..|||...:..:           :.:.|.     ||.      
  Fly   318 TTATTPPSSGLGAHSSGESLHSKAHGLLDKASVL-----------MQMFAS-----THL------ 360

  Fly   316 GKIRVSQKRVPNTFIDDALPKFKAYDAQRLRLLQNRKMSLSSEGGVGIEAKPSSSLKSHDLKEED 380
                                                             .||    ::|| :.:.
  Fly   361 -------------------------------------------------VKP----RTHD-EFQQ 371

  Fly   381 EEEQEQHKGHDDSQDSQAKPLVQLQLTGAEEGAAPRPLEDNKENKSPEKRPLLRGQSQIELGHKE 445
            ...::.|||:... |.:|    ||::...|..|....|..::|..:..||.|.:.|.|.|  ..|
  Fly   372 NSLKKTHKGNHWG-DLRA----QLEVDIQEVAALAATLSCDREKLANIKRALRKQQQQAE--STE 429

  Fly   446 HSDGSQPL--AANSQLEAPNVIVNKQPT----PPRDQGVGTGTASASAGPSQLHPNYAMDNIPKQ 504
            .||...|:  :.|..|..|.......||    .|...|   |..|:.:.....:.|:..:...|.
  Fly   430 FSDTGNPVINSQNGALTLPPRCRRAVPTGHELAPYASG---GAISSDSDEDISYSNFEWEKESKS 491

  Fly   505 RDRSASQG 512
            |..:.::|
  Fly   492 RRTTHARG 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
plxNP_001163511.1 PTB_TBC1D1_like 301..601 CDD:269967 40/218 (18%)
DUF3350 835..880 CDD:288663
TBC 933..1152 CDD:214540
RILP-like <1176..1267 CDD:304877
CG3703NP_569874.1 RUN 516..703 CDD:280855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.