DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and YPT7

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_013713.1 Gene:YPT7 / 855012 SGDID:S000004460 Length:208 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:73/190 - (38%)
Similarity:112/190 - (58%) Gaps:14/190 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SMREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIM-LW 91
            |.|:.:|   :||:|:|:.||||:|::.||....:::.||.|||.|||.:::.:||:.|..| :|
Yeast     2 SSRKKNI---LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVW 63

  Fly    92 DTAGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKV-----ENECNEIPTVIVQNKI 151
            ||||||.|..:..|:||||...|||:..|:.:||:.||.|:.:.     .|.....|.||:.|||
Yeast    64 DTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKI 128

  Fly   152 DLIE-QAVVTADEVETLAKLL-NCRLIRTSVKEDINVASVFRYLATKC---HQLMTQSYD 206
            |..| :.:|:....:.|||.| :..|..||.|..|||.:.|..:|...   :|..|::::
Yeast   129 DAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQADTEAFE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 61/159 (38%)
Rab23_like 50..197 CDD:133306 61/154 (40%)
YPT7NP_013713.1 Rab7 9..182 CDD:206655 68/172 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.