DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and RHA1

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001330210.1 Gene:RHA1 / 834549 AraportID:AT5G45130 Length:208 Species:Arabidopsis thaliana


Alignment Length:176 Identity:58/176 - (32%)
Similarity:102/176 - (57%) Gaps:14/176 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DIELA----IKV-----VIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRI 88
            ::|:|    ||:     |::|:.|.||||::.|:.|..|.:..:.|||..|..:.:.::...|:.
plant     5 ELEIAWFISIKLGFGVKVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKF 69

  Fly    89 MLWDTAGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTVIVQ---NK 150
            .:|||||||.:..:...|||||.|:::||..|::|||:..|.|.::::.:.|  |.:::.   ||
plant    70 EIWDTAGQERYHSLAPMYYRGAAAAIIVFDITNQASFERAKKWVQELQAQGN--PNMVMALAGNK 132

  Fly   151 IDLIEQAVVTADEVETLAKLLNCRLIRTSVKEDINVASVFRYLATK 196
            .||::...|:|:|.|..|:..:...:.||.|...||..:|..:|.:
plant   133 ADLLDARKVSAEEAEIYAQENSLFFMETSAKTATNVKDIFYEIAKR 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 50/150 (33%)
Rab23_like 50..197 CDD:133306 50/150 (33%)
RHA1NP_001330210.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.