DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and RAB7A

DIOPT Version :10

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_565521.1 Gene:RAB7A / 816724 AraportID:AT2G21880 Length:212 Species:Arabidopsis thaliana


Alignment Length:165 Identity:57/165 - (34%)
Similarity:90/165 - (54%) Gaps:8/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDCI 102
            :||:::|:.||||:|::.:|....|.|.||.|||.||:.:::.||.:.|.:.:|||||||.|..:
plant    10 LKVIVLGDSGVGKTSLMNQYVYKKFNKQYKATIGADFVTKELHIDEKSVTLQIWDTAGQERFQSL 74

  Fly   103 TKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEI-----PTVIVQNKIDL---IEQAVV 159
            ..|:||||...|||:...:..||:.:.:|..:...:.|.:     |.|::.||.|:   ..:.|.
plant    75 GAAFYRGADCCVLVYDVNNLKSFETLNNWHTEFLKQANPMEPETFPFVLIGNKTDVDGGNSRVVS 139

  Fly   160 TADEVETLAKLLNCRLIRTSVKEDINVASVFRYLA 194
            ....:|......|.....||.|||.|:...|..:|
plant   140 NKRAIEWCGSKGNIPYHETSAKEDTNIDEAFLSVA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Rab23_like 50..197 CDD:133306 51/153 (33%)
RAB7ANP_565521.1 Rab7 10..181 CDD:206655 57/165 (35%)

Return to query results.
Submit another query.