DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and RAB5B

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001238965.1 Gene:RAB5B / 5869 HGNCID:9784 Length:215 Species:Homo sapiens


Alignment Length:191 Identity:61/191 - (31%)
Similarity:105/191 - (54%) Gaps:15/191 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDCIT 103
            |:|::|...|||||::.|:.||.|.:..:.|||..||.:.:.:|...|:..:|||||||.:..:.
Human    22 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLA 86

  Fly   104 KAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTVIVQ---NKIDLIEQAVVTADEVE 165
            ..|||||||:::|:..|::.:|...|.|.::::.:.:  |::::.   ||.||..:.:|..:|.:
Human    87 PMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQAS--PSIVIALAGNKADLANKRMVEYEEAQ 149

  Fly   166 TLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAG----------NQQNSS 216
            ..|...:...:.||.|..:||..:|..:|.|..:...|:....||          :|||.|
Human   150 AYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 49/151 (32%)
Rab23_like 50..197 CDD:133306 48/149 (32%)
RAB5BNP_001238965.1 Rab5_related 20..182 CDD:206653 54/161 (34%)
Effector region. /evidence=ECO:0000255 49..57 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..215 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.