DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and rab20

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_012812505.1 Gene:rab20 / 550049 XenbaseID:XB-GENE-494912 Length:272 Species:Xenopus tropicalis


Alignment Length:225 Identity:55/225 - (24%)
Similarity:98/225 - (43%) Gaps:48/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLIQTAT--GGAAASVLQTHSQAQYNYTSMREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTK 64
            ||..|.:  |...:.|:|   :..:..:||::.|    :|:|::|:..|||:|::.||.:..| :
 Frog    22 RLDATGSKDGRPGSDVMQ---RLWFQTSSMKKPD----LKLVLLGDMNVGKTSLLHRYMERRF-Q 78

  Fly    65 DYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIK 129
            |...|:|..|..:|    .....|.:|||||:|:|..:...|.|.|.|.:|.:..::..|...::
 Frog    79 DTVSTVGGAFYLKQ----WGPYNISIWDTAGREQFHGLGSMYCRAASAVILTYDVSNMQSLLELE 139

  Fly   130 DWKRKVENECN-EIPTVIVQNKIDL--------------------IEQAVVTADEVETLAKLLNC 173
            |....:.:..| :....:|.|||||                    |.:.|...|.:....:::..
 Frog   140 DRFLGLTDTANDDCIFAVVGNKIDLTDDYDSESDMEGERPRTSSKIRKQVDLEDAIALYKRIMKY 204

  Fly   174 RLI-------------RTSVKEDINVASVF 190
            :::             .||.|...||..:|
 Frog   205 KMLDENVVPAAEKMCFETSAKTGYNVDGLF 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 41/175 (23%)
Rab23_like 50..197 CDD:133306 41/175 (23%)
rab20XP_012812505.1 Rab20 53..272 CDD:133326 46/187 (25%)
Ras 54..235 CDD:278499 46/186 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.