Sequence 1: | NP_649574.1 | Gene: | Rab23 / 40701 | FlyBaseID: | FBgn0037364 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001026847.1 | Gene: | RAB24 / 53917 | HGNCID: | 9765 | Length: | 203 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 59/196 - (30%) |
---|---|---|---|
Similarity: | 101/196 - (51%) | Gaps: | 20/196 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 IKVVIVGNGGVGKSSMIQRYCKGIF-TKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDC 101
Fly 102 ITKAYYRGAQASVLVFSTTDRASFDAIKDW---KRKVENECNEIPTVIVQNKIDLIEQ----AVV 159
Fly 160 TADEVETLAKLLNCRLIRTSVKEDINVASVFR-----YLATKCHQLMTQSYDQVAGNQQNSSHPP 219
Fly 220 Y 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab23 | NP_649574.1 | Ras | 50..199 | CDD:278499 | 46/161 (29%) |
Rab23_like | 50..197 | CDD:133306 | 46/159 (29%) | ||
RAB24 | NP_001026847.1 | Rab24 | 8..201 | CDD:133318 | 59/196 (30%) |
Effector region. /evidence=ECO:0000250 | 37..45 | 4/7 (57%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1340129at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |