DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and RabX1

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster


Alignment Length:212 Identity:64/212 - (30%)
Similarity:103/212 - (48%) Gaps:9/212 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KVVIVGNGGVGKSSMIQRYCKGIFTKDYKK--TIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDC 101
            ||:::|:.||||:.::.||.|....:...:  ||.|.|....|.:|...:::.:|||||||.:..
  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71

  Fly   102 ITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTV--IVQNKIDLIEQAVVTADEV 164
            :...|||.|.|::|||..|...:|..||.|.:::.....: |.:  :|.||:|:..|..|:.:|.
  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQD-PMILTLVGNKMDMQAQRAVSREEA 135

  Fly   165 ETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNSSHPPYSSTPTISAF 229
            ...|..:......||.:.|..:..||...|....:|..:.......:.|::....|::|.|  ||
  Fly   136 FVFATSIGATYFETSTETDQGLEQVFISTAQGLVRLADEGKSPSLRSFQSTDSLAYTNTNT--AF 198

  Fly   230 SPTFT--KSSSGTIVLR 244
            |.|..  ..|||....|
  Fly   199 SHTVAALARSSGNAAFR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 45/152 (30%)
Rab23_like 50..197 CDD:133306 45/150 (30%)
RabX1NP_524713.1 Ras 7..166 CDD:278499 50/159 (31%)
Rab 7..166 CDD:206640 50/159 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.