DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab1

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster


Alignment Length:206 Identity:69/206 - (33%)
Similarity:105/206 - (50%) Gaps:26/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QYNYTSMREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVR 87
            :|:|          ..|::::|:.|||||.::.|:....:|:.|..||||||..|.||:||:.::
  Fly     7 EYDY----------LFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIK 61

  Fly    88 IMLWDTAGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVEN-ECNEIPTVIVQNKI 151
            :.:|||||||.|..||.:|||||...::|:..||:.||:.:|.|..::|. .|..:..::|.||.
  Fly    62 LQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKS 126

  Fly   152 DLIEQAVVTADEVETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNSS 216
            ||..:.||........|..|....:.||.|...||...|..:|.:.               :|..
  Fly   127 DLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEI---------------KNRV 176

  Fly   217 HPPYSSTPTIS 227
            .||.|:|...|
  Fly   177 GPPSSATDNAS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 56/149 (38%)
Rab23_like 50..197 CDD:133306 56/147 (38%)
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 62/189 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.