DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab11

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster


Alignment Length:203 Identity:69/203 - (33%)
Similarity:119/203 - (58%) Gaps:4/203 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 REDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTA 94
            |||:.:...|||::|:.|||||:::.|:.:..|..:.|.||||:|..|.||:||:.::..:||||
  Fly     4 REDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTA 68

  Fly    95 GQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNE-IPTVIVQNKIDLIEQAV 158
            |||.:..||.||||||..::||:......:::.::.|.|::.:..:: |..::|.||.||.....
  Fly    69 GQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRS 133

  Fly   159 VTADEVETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSY--DQVAGNQ-QNSSHPPY 220
            |..||.:..|:......|.||..:..||.:.|:.:.|:.:::::|..  |...|:. :.|:..|.
  Fly   134 VPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNVEPI 198

  Fly   221 SSTPTISA 228
            ...||::|
  Fly   199 DVKPTVTA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 51/149 (34%)
Rab23_like 50..197 CDD:133306 51/147 (35%)
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 58/163 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.